KEGG   Leuconostoc carnosum: C270_05605Help
Entry
C270_05605        CDS       T02321                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00010  Glycolysis / Gluconeogenesis
lcn00260  Glycine, serine and threonine metabolism
lcn00680  Methane metabolism
lcn01100  Metabolic pathways
lcn01110  Biosynthesis of secondary metabolites
lcn01120  Microbial metabolism in diverse environments
lcn01130  Biosynthesis of antibiotics
lcn01200  Carbon metabolism
lcn01230  Biosynthesis of amino acids
Module
lcn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C270_05605
  09102 Energy metabolism
   00680 Methane metabolism
    C270_05605
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C270_05605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcn04131]
    C270_05605
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcn04147]
    C270_05605
Enzymes [BR:lcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     C270_05605
Membrane trafficking [BR:lcn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    C270_05605
Exosome [BR:lcn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   C270_05605
  Exosomal proteins of melanoma cells
   C270_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFT82030
UniProt: K0DAZ3
LinkDB All DBs
Position
complement(1172154..1172819)
Genome map
AA seq 221 aa AA seqDB search
MVAQLVLVRHGESTANRNNEFTGWTDVPLTPKGRQQAKQVGQKLAEHQILFNQVHTSYLQ
RAITTANIILFEMNQSWLPMTKTWRLNERHYGALRGLNKDLARKEYGFEAVALWRRSYTA
VPTLLTKVTPDRRYPNGLEPYGESLKMASDRLLPYWTQVIEPALKAGKNQLIVAHGSSLR
ALVKYLEHISDEDIDGLEIGNGEPISYTFDDEFNMSHRHYL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgcaacttgtcttggttcgccatggggaatcaacagctaatcgtaataatgaa
tttacggggtggacggatgttcctttgacacctaaaggtcgccagcaggctaaacaagtt
gggcagaagttagctgagcaccaaattctttttaatcaagtacatacttcttatttgcaa
cgtgcaattactaccgccaatattattttatttgaaatgaatcaatcttggttaccaatg
actaaaacttggcgtcttaatgagcgtcattatggtgctttgcgagggcttaataaagat
cttgctagaaaagaatatggttttgaagcggtagccttatggcgaagaagttatacagcg
gtaccgacactattaacaaaggtgacaccagatcgtcggtatcctaatggattagagccg
tatggagaaagccttaaaatggctagtgatcgcttgttaccttattggactcaagtgatt
gaaccagcacttaaggctggaaaaaatcagctgattgttgctcatggcagcagtttacgt
gcactggttaagtatttagaacatattagtgatgaggatattgatgggctagaaattggt
aatggggaaccgatttcttatacttttgatgatgaatttaacatgagccaccgtcattat
ttataa

DBGET integrated database retrieval system