KEGG   Larimichthys crocea (large yellow croaker): 104917777
Entry
104917777         CDS       T04659                                 

Gene name
nr3c1
Definition
(RefSeq) LOW QUALITY PROTEIN: glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104917777 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104917777 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lco03310]
    104917777 (nr3c1)
Transcription factors [BR:lco03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    104917777 (nr3c1)
Nuclear receptors [BR:lco03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   104917777 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 104917777
NCBI-ProteinID: XP_027129225
LinkDB
Position
XXII
AA seq 781 aa
MDQHGLKRNGXSRRQSDIWGGSSWRRQXDTGDTADSMLESAMHLPGPGSLPQPMMPPNGQ
GGTKDQEGIMVRVLKPPQQQHNPDIDLINMEDDLLLKQRADLSSTSVISTSDVSVFGNLP
LPDLFPQHIKQEGTYSLDKHLETYSEHTGTGPNDLDAKSARLMEDTEIWQDLDLPSSLPE
ISDFELDSEVAHLGNILLDSRGGDGLLKETKSLVGNGINRTNVNGSEHPIQHHSHQQQQQ
HHHLLQHQQHQLHQQQQQQQPASLLSSVMIKEEKDPGDPLIHIRTPGVVKQEKQDTPGFC
QAQCLQSGMSSLHGGGPMPSPMGVRAGPGYHYRGNQFSTVGLQDQKPIGMYSNLPVVGEN
WARGNRYGEPSGIQRSDDGLPTAAALASFSVSFAGSSPRAGDTSSPVVPVQSKPSGQSHK
ICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIIDKIRR
KNCPACRFRKCLQAGMNLEARKNKKLMKKPSGSSQPINNMPIPVIPKCMPQLVPTMLSML
KAIEPEVIYSGYDSTLPDTSTRLMTTLNRLGGQQVISAVKWAKSLPGFRNLHLDDQMTLL
QCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINEERMKLPFMTDQCEQMLKICNEFVRL
QVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREENASQNWQRFY
QLTKLLDSMQEMVESLLQICFYTFVNKTLSVEFPEMLAEIISNQIPKFKDGSVKPLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggatcagcatggactgaagcgcaacggtnaatcgagacgacagtctgacatttgggga
ggcagtagctggaggaggcagnntgatacaggtgacacagctgattcaatgctcgagtct
gcaatgcacctgcctggtcctggatctctgccccagcccatgatgcccccaaatggacaa
ggtggaaccaaagaccaggagggaataatggtcagggtactgaaaccaccacaacaacaa
cacaacccggatattgatctaatcaacatggaggacgacttgttgttaaaacagagagct
gatctctcgtccacctcagtcatcagcacctcagatgtatccgtcttcggtaacctgcct
ctgcctgacctttttccccagcacatcaagcaggaggggacttattctctggataaacac
ttggaaacttacagtgaacacacaggcactggtcctaatgatttggatgccaagagtgct
cgcttaatggaggataccgagatttggcaagacttggaccttcctagctctctgcctgaa
atcagtgattttgagttggattcagaagtagcacacttgggtaacatcctactcgacagc
aggggcggcgacggcttgctaaaggaaacaaagtctcttgtgggtaacggaataaaccgt
accaatgtgaacggctcagaacaccccattcagcatcattctcaccagcagcagcaacag
caccaccaccttctacagcaccagcaacatcagcttcatcagcagcagcagcagcagcag
cctgcgtcgcttctctccagcgttatgatcaaggaagagaaggatcctggcgacccttta
atccacatccgcactcctggtgtggtcaaacaggagaagcaggacacccctggtttctgc
caggcgcagtgtctccagagcggcatgagctctctccatggaggaggccccatgccttca
cctatgggtgtcagagcaggtcctggctaccactacagaggcaaccagttctccacagtg
ggcctacaagaccagaagcctattggcatgtactcaaacctgcctgtggttggggagaac
tgggccagggggaacagatatggagagccgtctgggatacagaggagtgacgatgggctc
cccaccgccgcagccttggcatctttctccgtcagcttcgctggctcatcacccagagca
ggagacaccagcagtcctgtggtgccggtccagtccaagcccagtggtcagtcgcataag
atctgtttagtgtgttcagacgaagcctcaggatgccactacggggttgtaacctgcggc
agctgcaaggtgttcttcaagagggccgtcgaaggatggagagcacgacaaaacacagat
ggccaacacaactacctgtgcgcggggagaaatgactgcatcattgataagatccggagg
aagaactgtccagcctgtcgcttcaggaaatgtcttcaagccggaatgaacttggaagcg
aggaaaaacaagaagctaatgaagaaaccctctggatcatcacagcctatcaacaacatg
cctattccagtcatccccaagtgcatgccccaactcgtgcccaccatgctgtctatgctc
aaggccatcgagcccgaagtcatctactcgggatatgacagtacactgcctgacacctcc
acgaggctcatgaccactctgaacaggcttggaggacagcaggtcatctctgcagtcaag
tgggctaagtcactgccaggcttccgaaacctgcacctggatgaccagatgacactgctg
cagtgctcctggctcttcctcatgtccttcagtcttgggtggaggtcatacgagcagtgt
aacgggagcatgctctgctttgcccctgatcttgtcatcaatgaagagcgtatgaagttg
cccttcatgaccgaccagtgcgagcagatgctgaagatctgtaatgagtttgtcagactg
caggtgtcctatgacgagtacctgtgcatgaaggtcctgttactgctcagtacagtaccg
aaagatggcctgaagagccaggcagtgtttgacgagatcaggatgacgtacatcaaagag
ctgggaaaagccatcgtcaaaagagaggagaacgccagtcagaactggcagcgcttctac
cagctaactaagcttttggactcaatgcaggagatggttgagagtcttctccagatctgt
ttctacaccttcgtgaataaaaccctcagtgtggaattcccggagatgctggcggagatc
atctccaaccagataccaaaattcaaagacgggagcgtcaagcctctgctgtttcaccag
aaatga

DBGET integrated database retrieval system