KEGG   Larimichthys crocea (large yellow croaker): 104917779
Entry
104917779         CDS       T04659                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104917779 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104917779 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104917779 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:lco00536]
    104917779 (fgf1)
Cytokines and growth factors [BR:lco04052]
 Growth factors
  Growth factors (RTK binding)
   104917779 (fgf1)
Glycosaminoglycan binding proteins [BR:lco00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104917779 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 104917779
NCBI-ProteinID: XP_010727619
LinkDB
Position
XXII
AA seq 203 aa
MKAALSFPSCFFFSCLRHSPGDTTCERSGSSLSLQTQELYSASSKPQPLCRMSEGNVTVM
PFGPSSLDLSRQEQRTLTRLYSQNGGYHLRILLDGTVNGGRQENDPYDILRIKAVSVGVV
VIKGEMTGRYLAMNKKGRLYGSQALNDECYFLEKYEENHYNTYCSQKYNWYVGLKRNGQP
KAGPDTHQGQKAVFFLPRPAGNM
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaaggcggcgttgtccttcccttcctgtttcttcttctcgtgtctcagacacagtcca
ggtgacacgacttgtgaacgcagtggatcctctctgtcgttacagacacaggaactttac
tccgcttcgtccaagcctcaacctctgtgcaggatgtctgagggaaacgttacagtgatg
ccatttggaccttcatctctggacttgtccaggcaggagcaacggacgctgaccagactg
tacagccagaacggaggatatcacctgaggattttactagatggaactgtgaatggtggc
agacaggaaaatgacccttatgacatcctgaggataaaggctgtgagtgtcggagtagtg
gtcatcaagggcgagatgacaggaaggtacctagctatgaacaaaaaaggacgcctctac
ggatcacaagcactgaacgatgagtgttactttctggagaagtatgaagaaaaccactac
aacacatattgctctcagaagtacaattggtatgtggggctgaagaggaacggccaaccc
aaagcaggaccagacacccaccagggtcagaaggccgtcttttttctaccaaggcctgca
ggcaacatgtaa

DBGET integrated database retrieval system