KEGG   Larimichthys crocea (large yellow croaker): 104917921
Entry
104917921         CDS       T04659                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04012  ErbB signaling pathway
lco04020  Calcium signaling pathway
lco04068  FoxO signaling pathway
lco04510  Focal adhesion
lco04540  Gap junction
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104917921 (egf)
   04012 ErbB signaling pathway
    104917921 (egf)
   04068 FoxO signaling pathway
    104917921 (egf)
   04020 Calcium signaling pathway
    104917921 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104917921 (egf)
   04540 Gap junction
    104917921 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104917921 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104917921 (egf)
Cytokines and growth factors [BR:lco04052]
 Growth factors
  Growth factors (RTK binding)
   104917921 (egf)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF_3 DUF5050 EGF EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 104917921
NCBI-ProteinID: XP_010727808
LinkDB
Position
I
AA seq 1107 aa
MDLDGKNHKRLMAGVGSSILFDFNFREERVYWADMHTGVIYKASVRGAHRQKLYSSDKHI
SGLAVDWIWNSVYWTSGEKGKIKRMDINGENETTLLRHLTQPSSITVDPNNRFLFWLSGG
MTPSIQRSDTKGQKKTTLIKIAEQLKALSIDREEKRLYWVQFGLQGESAIASCDYNGKVL
HIVDQPLRSQSLGISVFLEHLYYTDTASRVIKQINKYTGGEPLNVNIKPMAKPPVNIMVV
HPLNQPMADSESSFPGCDEQSGNCVNVCSSLAEQGSCRCSEGFALSKQGTHCEDVNECAL
WNHGCSLGCENIPGSYFCTCPQGYALLPDRKTCQEIIPCEGNVTKCGHGCLTTDEGAVCV
CPEGSVLREDGQACTGCSSADRGGCSQLCTPVTPGRWQCGCLPGYQLHQDGMRCIASGPP
PYLLVADLVEIRKIHPDGTGDQTLVEEPRGTIIALDYDPVQNNVYFASTSQKTIERVDLN
TGSRDILVSDGLDSPEGLAIDWVHRRMYWTDKSQSTVYCSTLAGLNRETIVSKGLEKPRG
IAVHPLAKKLFWTDIGSHPAVESASLKGKDRVVIASTNLVSPSGLTVDFTDDRLFWCDQR
RGLVETAALDGSDRQVLLENHVGRPFDLAVFEDRLWISDQEHQQLRSVHKWTGKKLQRIH
SNMVQPASIVVVHPLAKPGADVCLHLNGGCAQVCESRLGFAHCSCLSHYILSADGKSCMP
ADVLKGVTESGDSESTSLRNKTFNDESTALTATPGLSTDKVEANLDTGVHSEPTLSTDTM
VSDQNECYSLGCDVNAQCLMITGSPTCLCLEGFTGDGRLCVDIDECQQGTHKCDKNAECQ
NTLGKYLCKCPAGYHSNGRACEAFQTTSPWLTTASPADVTTQPHNSNSIESCPSTHESYC
LYQGVCFYFPEMESYACNCAAGYMGERCQFSDLEWWELQQAEEEKRRNVVIAACMVVLVS
LLSIAACVTYCYGTRKFFQKRPSVDNVSETSVTDESMSQSTTSSVPRFYMMVENGVEGMV
TPATGCPRRAVCPSCSSETGENSAHEDLGTLSNHNRAYECSMVSTFAMETARPALHDSCS
SLSSSYTCTTFKPPPPSQTPSSESPAS
NT seq 3324 nt   +upstreamnt  +downstreamnt
atggaccttgatgggaagaaccacaaaaggctcatggctggggtgggaagttcgatcctg
tttgactttaatttcagagaagagagagtttactgggctgacatgcacactggggtcatc
tacaaagcctcggtgagaggagcacacagacagaaactgtactcatctgacaaacatatc
tcgggccttgcagtggactggatttggaacagtgtatactggacaagtggggaaaaggga
aaaatcaagagaatggacataaatggggaaaatgaaacgactcttttaagacacttgacc
caaccaagttccataacggttgaccccaataacagatttctcttctggctgtctggtggg
atgactccaagtatccagaggtctgatacgaaaggtcagaagaaaactacacttattaaa
atagctgaacaactgaaggcactgtcgattgaccgagaagagaaaagactgtactgggtt
cagtttggtctgcaaggagaaagtgccattgcctcttgtgattacaacgggaaagtcttg
cacatcgtagatcagccacttcggtcgcagtcactggggatatcagtttttctagagcac
ttatactacactgacactgcatctcgggttataaaacaaataaacaagtacactggtgga
gagccgctgaatgttaacataaaaccaatggcaaaacctccagttaatattatggtggta
catcccctcaaccagccaatggcagactccgaatcatcgtttccaggttgtgatgaacag
agtggaaattgcgtgaatgtgtgttccagtctggccgagcaagggtcttgtcgatgcagc
gaaggctttgctctcagtaagcaaggcactcattgtgaagatgtgaatgaatgtgccctc
tggaaccatggctgctctcttggctgtgaaaacatcccaggctcctatttctgtacctgt
cctcaaggatatgccctccttccagacaggaagacatgtcaagagatcataccatgtgaa
gggaatgtcaccaagtgtggccatggatgcctgacgacagatgagggtgcagtctgtgtg
tgtcctgaggggtctgtactacgtgaggatggacaggcgtgtactggctgttcgtctgca
gacagaggggggtgcagtcagctctgtactcctgtcaccccaggtaggtggcagtgtggc
tgtctgcctggctaccagctccaccaagatggcatgcgctgcattgcttcaggaccacca
ccttatctactagtcgcagatttagtggagatacggaaaattcatcctgatggcactgga
gatcaaactcttgtggaggagcccagaggaacaatcatagctttggactatgaccctgtc
cagaacaatgtgtactttgccagtacaagccagaagacaattgagcgggttgatttgaac
actggctcaagagacattcttgtctctgatggtttggactctccagaaggactggccatt
gactgggtccaccgcaggatgtattggacagataaaagccagtcaactgtttactgcagt
accttggctggactgaacagagaaaccattgtaagcaaagggctggaaaaaccaagagga
atcgcagttcatcctttggcaaagaagttgttctggactgatataggcagccaccctgct
gtggaaagtgcttctttgaaaggaaaagaccgcgtcgtcattgctagcaccaaccttgtg
tcaccgagcggcctgactgttgatttcaccgatgaccgtctgttctggtgtgaccagagg
aggggcctggtggagactgctgccctggatggttctgatcgacaggtcctgttagagaac
catgtaggtcggccctttgatcttgcagtatttgaggacaggttgtggatatctgatcag
gaacaccagcagctgaggagcgtacacaagtggactggaaaaaagctgcaacgtatccat
agcaacatggtccaaccagcatccattgtggtggttcatccccttgctaaaccaggagca
gatgtttgcctccacctgaatggaggttgtgcccaggtgtgtgaaagcagactgggattt
gcccactgctcctgtctgtcacattacatcctatcagctgatggaaaaagttgcatgcct
gctgatgttttaaaaggagtaacagaatctggagacagtgaatcaacgtctctcagaaac
aaaacattcaacgatgagagcacagccctgacagcaacacctgggctgtccactgataaa
gtggaggctaatttagacaccggtgtacacagtgagccgactctctccacagacacgatg
gtttcagaccagaatgagtgttactcacttggctgtgatgtgaatgcacagtgcctgatg
atcactggtagcccaacctgtttgtgtctggaaggtttcacaggcgatggacggttgtgt
gtggatatcgatgagtgtcaacagggaacgcacaaatgtgacaaaaatgcagaatgccaa
aatacgttgggaaaatacctctgcaagtgcccggctggataccacagcaatggaagagca
tgtgaagcatttcagaccacgtcgccatggttgacgactgctagccctgccgatgtcacc
acccagccccacaacagtaactcaatagagagttgcccctccacccatgagtcctactgt
ctgtaccagggtgtctgcttctactttcctgaaatggagtcctatgcttgcaattgtgca
gctggctacatgggggagcgttgtcagttcagtgacctggagtggtgggagcttcagcag
gccgaggaggagaagagaagaaacgtggtcattgcggcctgcatggtggtcctcgtttcc
ctgctctccatcgccgcttgtgtcacctactgctacggaactagaaaattcttccagaaa
cgtccctcggtggataacgtaagtgagaccagcgtaacagatgagagcatgtcgcagtcc
actacgtccagtgtgcctcggttctacatgatggtagaaaatggtgtggaaggaatggtc
acccctgccacaggctgtcccaggagagcggtctgtccgtcctgctcttcagaaacaggt
gaaaactctgcgcatgaagacttgggaacactgtccaatcacaaccgagcatacgagtgc
tccatggtgtcaacatttgccatggagaccgcccggcccgccctccatgattcatgttca
tcactgtccagctcatatacttgcacaacctttaaaccaccccctccctcccaaactccc
agctcagagtcccctgcttcctag

DBGET integrated database retrieval system