KEGG   Larimichthys crocea (large yellow croaker): 104918009Help
Entry
104918009         CDS       T04659                                 

Definition
(RefSeq) transmembrane protease serine 4-like
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lco01002]
    104918009
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     104918009
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104918009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR Trypsin_2 DUF1986 Ldl_recept_a DUF5467
Motif
Other DBs
NCBI-GeneID: 104918009
NCBI-ProteinID: XP_010727919
LinkDB All DBs
Position
Un
AA seq 462 aa AA seqDB search
MWAITQVPEESIAPLNPRHQVQVVPRPGRHRRPMTATKTQKDKASKAKKVLLTALTVVVL
LGILVTAGYFIKQLIDSKYFFCKSAVKFIPIDQACDGKNDCAGGEDEITCLSTFTVNTTF
PVRLTSARHVLQVYNPGQGWRSVCRDDWTEQHTQTACKQLGYTNNPQSSGVTVDKLIPSM
KTGPFTAVRPMTGTTPIHEATMDRAVCRSGSVVSLSCSDCGQVGSQDRIIGGTDAFIEDW
PWQVSLQVGGNHVCGGSLVSPRWVVTAAHCFSGSKKELSRWRVVSGRTYMSTLGGSYVDR
IIMNGNYDAAQNDYDIALMRLSSPITVGVARKPVCLPPKAFSLAAKSTMAVTGWGYLEEN
GKVSPSLQKASIPLIDQSVCSSPIVYGSAITQRMICAGFMEGKVDACQGDSGGPLVHFTS
SRWHLVGVVSWGVGCGRERRPGVYCNVEEMLNWINTVIEKNP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgatcacccaggtgcctgaggaaagcattgcaccgttgaatcctaggcatcaa
gtacaagtagttccacggccaggtcgccacagaaggcccatgacagccacaaagactcag
aaagacaaagcgtctaaggcgaagaaagtgttgctgactgccctcacagttgtggtgtta
ctgggcatactagttacagcaggatacttcattaagcagctgattgatagcaaatatttc
ttctgcaagagcgcagtgaagttcatcccaattgaccaagcctgtgacgggaaaaatgac
tgcgccggtggagaggatgaaattacctgtctgtcaacttttacggtcaacactaccttt
ccagtgcgtctcacatcagctcggcatgtcctgcaggtgtacaaccctggccaaggttgg
cggagtgtgtgtcgtgatgactggaccgagcagcacacacaaacagcatgtaaacaactg
ggatacacaaataatcctcaaagcagcggtgtcacagtggataaattgataccttccatg
aaaactggaccattcacagctgtcaggcctatgactgggactacacccatacacgaagct
accatggaccgcgctgtatgcagatctggatctgtggtatctttgtcctgttcagactgt
ggacaggtaggctctcaggaccgtattattgggggtacagatgctttcattgaggactgg
ccatggcaggttagcctacaagtgggaggcaaccacgtatgtggaggctcgctggtgtca
ccgcgttgggttgttactgcagcccactgctttagtggcagtaaaaaagagctgagtcgc
tggagagtggtgtcaggccggacatacatgagcacactgggaggttcctatgtggacagg
atcataatgaatggcaactacgatgcagcacaaaacgactatgacatagcactgatgaga
ctcagcagtccgatcacagtgggagtggcccgcaagccggtttgtctacctcctaaagcc
ttcagccttgctgccaaatccaccatggccgtgactggctggggatacctagaggaaaac
ggtaaggtttctccgtcacttcagaaggcctctatccctctgatagaccagtctgtgtgt
tccagccccatagtgtacggtagtgccataacccaaaggatgatctgtgctggtttcatg
gaggggaaagtggatgcctgtcagggggacagtgggggtcctttggtgcacttcacctcc
tctcgatggcatctggtaggagtggtgagttggggtgttggctgtggtcgggagagacga
ccaggtgtctactgcaatgttgaagagatgctaaactggattaatacagtcattgagaaa
aacccctaa

DBGET integrated database retrieval system