KEGG   Larimichthys crocea (large yellow croaker): 104918571
Entry
104918571         CDS       T04659                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104918571
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104918571
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lco04030]
    104918571
G protein-coupled receptors [BR:lco04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    104918571
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 TMEM192
Other DBs
NCBI-GeneID: 104918571
NCBI-ProteinID: XP_019120535
UniProt: A0A6G0HVW1
LinkDB
Position
XII
AA seq 368 aa
MAKEISGWSTCDYNHNVTFFYNLVGKKISEEWTTRDSVVIGLGLTVCLIVVLANLLVMVA
IFMNQRFHFPIYYLLGNMAAADLFAGIAYVNLMLNTGPWTSTLTKEQWYIRGALIDISLT
ASVANLLAVSVERHQSIFTMRLHSTMSKRRVVLVIVCIWAVAIIMGLVPSTIWNCECDLK
DCSTVAPLYSRRFLIFWAVLNLLTFFIMVAMYTRIFIYVRYKSRYASRHTSEMRHNQAVV
NLMKTISMVLGAFVICWTPGLMTLLLDGLLGKDSNANSYEKFCLVIAECNSLVNPIIYSL
RDDEMRMTFKSILCCLCRRNAGQQRERSPVETFSPEPKETLVCVQKSEDQTACMERNNKE
DSWTMQGL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggccaaagagatcagtgggtggagtacctgcgactacaaccacaatgtcactttcttc
tacaacttggtggggaagaagatcagtgaagagtggacgacgagggactctgtggtgatc
ggacttggcttgacagtatgtctcatcgtagtcctggccaacctgctggtgatggtggcc
atcttcatgaaccaacgcttccacttccccatctactatctcctgggtaacatggctgca
gcagaccttttcgcaggtatcgcctacgtcaacttgatgctgaacacaggcccatggacg
agcacgctcaccaaggagcaatggtacatccgcggggctttgattgacatcagcctgaca
gcctcagtggccaacctgctggctgtctccgtggagcgtcatcagtccatcttcaccatg
cggctgcacagcacgatgtccaagcggcgtgtggtgctcgtgatagtgtgcatctgggcc
gtggctatcatcatgggtctggtgccttcgacgatttggaactgcgagtgtgatctgaaa
gattgctccacagtggcgccgctctacagtcgccgcttccttatcttctgggcagttctc
aacctgctcacattctttattatggtggctatgtacactcgtatcttcatctatgtgaga
tacaagagccgttatgcatctcggcacacttcagagatgaggcacaaccaggctgttgtc
aacctgatgaaaaccatctccatggtcctgggcgccttcgtaatctgctggacacccggc
ctcatgactctgttactggacgggctgttgggtaaagacagtaatgccaattcctatgaa
aagttctgcttggtgatagctgagtgcaactctctggtcaaccccatcatctattctctg
cgagatgacgagatgcgcatgacattcaagtccatcctgtgctgcctgtgtcgaagaaat
gccggccagcagagggaacggtcacctgtcgagactttctcaccagagccaaaggaaact
ctcgtctgtgtccagaagtcagaagatcagactgcctgtatggaaagaaacaataaagaa
gacagttggacaatgcaggggctatga

DBGET integrated database retrieval system