KEGG   Larimichthys crocea (large yellow croaker): 104918857Help
Entry
104918857         CDS       T04659                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
lco04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104918857 (gaa)
   00500 Starch and sucrose metabolism
    104918857 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104918857 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104918857 (gaa)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104918857 (gaa)
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104918857 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104918857
NCBI-ProteinID: XP_019132795
LinkDB All DBs
Position
XII
AA seq 929 aa AA seqDB search
MGLLSSSPAAVLLLAFALLTCLYINHVSNHDSRLVRSVCAKPNKSKAHERFVNEAEPQSS
SEETRTDRTDVSTDIKCTMAPESRFDCARDRLLSQEECEERGCCYAPLPNSTGPPWCFYP
SLYPGYEMGPLTPSTRGQAATLTCATPSYLPKDVSSLQLEVIEETAGCLHLTLKDLSSPR
YEVELPVGVPESKDDSQEALYTTEFQSDPFGFIVRRKSNGRTIMNTTVAPLLFSDQYLQL
STALASSLVSGLGEHYTSLLLDLNWTSLTLWNGDVAPHADANLYGSHPFYIVQEEDGLAH
GVFLLNSNAIEVMLQPTPALTWVALGGILDLYVFLGPDPQSVIRQYLQVIGYPMMPPYWS
LGFHLCRWGYTTTNTTRQVAQRMHNAKFPMDVQWNDLDYAKQRRVFTFDPWRFGDLPEMV
EEFHKKGMKYILIQDPGISSTSPPGTYPPFDDGLKRDVFIKNATGHILIGKVWPGPTAFP
DFTNPETRRWWEDCIRDFHSKVPVDGLWIDMNEPSSFVQGSVDGCPDSDLENPPYTPSVV
GGQLNSKTLCMSAQQKLSTHYNLHNLYGLTEAYATHSALMKIRGKRPFVLSRSSYPSIGR
FSGVWTGDVRSDWEQLRYSIPAVLQFSLFGVPLVGADICGFEGNTTEELCVRWMQLGAFY
PFMRNHNDKPNAPQEPYIFGKKAQAAMRSALNLRYSLLPFLYTLFHHAHTSADTVARPLF
MEFPADSNSQTIDRQFLWGSSLLISPVLEQGAVELAAYLPPGTWYSLHNGQPFYSKGQYL
LLPAPLDTINVHVREGHIIPQQEPALTTTASRRNPFFLTVALSAGGWAWGDLFWDDGDSL
DTFEMGNHCYIIFIAGQSQVVSDPLRLNGALDGLVLGGLQVFGVPSPPLYVLANGDKVRD
FTYRSDTKVLTMTSLALPMSKVFTVQWLL
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgctgtccagctctcctgcagctgtgctcctcctcgcctttgctttgttgaca
tgtttgtatataaaccacgtgtctaaccatgacagcagactggtcagatcagtctgtgct
aagccaaataaaagcaaagcacatgaaaggtttgtaaatgaagcagaaccacagagcagt
tcagaggagacgcgcacagacaggactgatgtctccacagatattaaatgtaccatggca
ccagagagtcggtttgactgtgccagggacaggcttctcagccaggaggagtgtgaagag
aggggatgctgctacgcccccctgcctaactccacaggaccaccttggtgcttctacccc
agtttgtaccctggctacgaaatgggtcccctcactccctctacacgaggccaggctgcc
accctgacttgtgccaccccttcctatctccccaaagatgtctccagtctacagctagaa
gtcatagaagagactgcaggctgcttacacctcactttaaaggatttatcgtctccgcga
tatgaagttgagctcccagttggtgttcctgagagcaaagatgatagccaagaagccctc
tataccactgaatttcagtctgacccatttggcttcatagtacggcgaaaatctaatgga
aggacgattatgaataccacagtcgctcctctgctgttttctgaccagtacctacagctg
tccaccgcactggcctcttcccttgtgtctggccttggggagcattacacatccctcctc
ctggaccttaactggacttctctgactctctggaacggagacgtggcgcctcatgctgat
gctaacctctatggctcccacccgttctacatagtacaggaggaggatggcttggcccat
ggagttttccttctgaacagcaatgcaatcgaggtgatgttgcagccgacccccgctctc
acctgggtggctctcggaggaatcctggatctgtatgttttcttgggccctgaccctcaa
agtgttatacgacaataccttcaggtcattggctatccaatgatgcctccctattggtca
ctgggctttcatctgtgtcgctggggttacacaacaactaatacaacccggcaggtggcg
caacgcatgcacaatgcaaagtttcctatggatgtgcaatggaatgatctggactatgca
aaacagcgcagggtgttcacctttgacccctggcgattcggggacctcccagagatggtg
gaggagttccacaagaaaggcatgaagtacatcctcatccaggatccagggatcagtagc
accagccctcctggaacttacccgccctttgatgatgggctgaaacgagacgtcttcatt
aaaaatgctacaggacacatcctgataggaaaggtttggccgggcccaacagccttccct
gacttcaccaatccagagaccagacgctggtgggaggactgcatcagagattttcattct
aaagttcctgtggatggtctgtggattgatatgaacgagccctccagttttgtgcagggc
tcagtggacggctgtcctgacagtgatcttgagaaccctccctacacgcccagcgtcgtc
ggaggccagttgaactcaaaaaccctttgtatgtcggctcagcagaagctgtccactcac
tacaacctgcacaacctgtatggactgacagaggcctatgccacacacagtgctcttatg
aagatacgagggaagaggccgttcgtcctgtctcgctcctcctaccctagcattggacgc
ttctctggtgtctggacaggagatgtcaggagtgactgggagcagcttcgatactccatc
cctgcggtgctgcagttcagcctgtttggcgtcccccttgttggggcagacatctgtggc
tttgaaggcaacacaacagaggagttgtgcgtccgatggatgcagctcggggccttctat
ccatttatgagaaaccacaacgataagccgaacgctcctcaggagccctatatatttgga
aagaaggcccaggcagccatgcggagtgcattgaaccttcgttactcccttctcccattc
ctctacacgctcttccatcatgcacacacctctgctgacactgtggccaggcctcttttc
atggagtttcccgctgattctaacagtcagaccatagaccgacagttcctgtgggggagt
tcacttctcattagcccagtcttagagcaaggagcagtagagctggctgcatacctgccc
cctggcacttggtacagcctgcacaatggtcagcctttctacagtaaaggtcagtacctc
cttctgccagctcctctggacaccatcaacgtccatgtgagggagggacacattatccca
caacaggagcctgctttgacaaccacagcttcacgcagaaaccctttcttcctgacggtg
gcactgtcagctggcggctgggcctggggcgacttgttctgggatgacggggacagtctt
gacaccttcgaaatgggaaatcattgttacattatctttattgctggacagtctcaggtg
gtgagtgatcctctcaggctaaatggggccctggatggtctggtgctgggagggctgcaa
gtgttcggggtgccctctccacccctgtatgtattagccaatggggacaaagtcagggat
ttcacgtaccgcagtgacaccaaggttttgacaatgaccagcctggctttgccaatgtca
aaggtctttacagtccagtggcttctctga

DBGET integrated database retrieval system