KEGG   Larimichthys crocea (large yellow croaker): 104919088
Entry
104919088         CDS       T04659                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04020  Calcium signaling pathway
lco04144  Endocytosis
lco04510  Focal adhesion
lco04540  Gap junction
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104919088 (pdgfra)
   04020 Calcium signaling pathway
    104919088 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104919088 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104919088 (pdgfra)
   04540 Gap junction
    104919088 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104919088 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104919088 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lco04090]
    104919088 (pdgfra)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104919088 (pdgfra)
Protein kinases [BR:lco01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104919088 (pdgfra)
CD molecules [BR:lco04090]
 Proteins
  104919088 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE C2-set_2
Other DBs
NCBI-GeneID: 104919088
NCBI-ProteinID: XP_010729315
LinkDB
Position
XVII
AA seq 1472 aa
MDELKTYVVFGVLLVALVSVTSGLSPPTIVSNEEEFILKPNSMFNISCTGKRNVIWADPL
PKNTLVYTGYYTATLFISNATVENTGYYMCVYDSQEGELQDDPDDDNEAGIYVFVPDAQA
PFVPETPDNLIVPMEPSGVPISCRVSNPNSHVILRSVSSGEEMSALYDNKMGFFGNLSPG
QYQCETTLNGQTFTSLVYTVETEDLSEIEDFDVEVRASEETVRAGQPFNITCVTPTGLGF
LQQWLHPKKQAVGAVQLKQTFPDWVIYTLSIPHATSQDSGTYECSVTHEFSREVRVSSVS
VTVFEESSFVALDHSGILATESVNLLEETEFTILINAYPPPKVMWLKDGKAIPESYFVLT
KTSHLEGNRYQSILTLREALVKDNGEYTITATSGSRTAQFSFNLQVKAPTAMMFPPSSAP
QLLPNVEEMVVPLHTSFTLTCRGEAKLAWETPFEMPEKTQEDNSGLFVTTITVDNATAMH
TGYYICFYSRNTTDDTEDSSIYIYVPDPDAPFVPSPVPFGNHVLSDHEEMEIQCRVSDPS
ANVTLVNVDTQQPVPSVYDSKRGALGVFTAGTYVCKALINGEEHYSGEYIVHGWTGDAAL
HVELTAKRTALLVGDTITVTCLARGSEILEDHWKYPGKVANRAVKTVHENKRDQEILYTL
TIPQASTKDSGIYSCSITDIISNESQTKQLAIQVFGSEFLTIWPKFGEYESAELDEVREF
KAEISSFPSAHVTWLKDGIPLSDVTAEISTSLRQVSETSYMSVLTLIRAKEEDSGNYTMR
VENGDQRRNVGLMLEVKVPAVIVDLMDIHHGSATGQSVVCITRGQPTPVVEWFVCKNIKH
CANDSSSWVPLPANSTEISMDSHFDEENNLESQVMFGHLENTLAVRCLARNEMAAVSREV
KLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIY
VDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR
SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFL
SLNPEKNNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNTSK
YSDIQGSNYDHPPSQKGSNEGEMDDLLSDDMNEGLTTTDLLSFTYQVAKGMEFLASKNCV
HRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTL
SDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWNS
EPEKRPSFLGLSDTVASLLPSSYKRHYERVNHEFLKSDHPAVTRVCMENNDAYIGITYKN
QGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHGSQTSEESAIETGSSSS
TFAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggatgagctgaagacgtatgtcgtctttggagttctcttggtggcgctggtttcggtt
acctccgggctgtcgccaccaaccatcgtgtccaacgaagaggagttcatcctcaagcct
aactccatgttcaacataagctgtaccggtaaaaggaacgtgatctgggctgaccccctg
cccaaaaacaccttagtttacacaggatactacacggcgacgcttttcatctccaacgcg
actgtggagaacaccggctactacatgtgcgtctatgacagccaggaaggtgaactgcag
gacgacccggatgacgacaacgaggcgggaatatatgtgtttgtcccagatgcccaggct
ccatttgtccctgagacacccgataacctgatagtccccatggaaccaagcggagtcccc
atctcctgccgtgtgtcgaaccccaactctcacgtcatcctgaggagtgtttccagtgga
gaggagatgtctgccctctacgacaacaagatgggcttctttggaaacctctcgcccggg
cagtaccagtgtgaaaccactctgaacggccagacgttcacaagtctcgtttacaccgtg
gagacggaggacctctctgagattgaggattttgacgtggaagtaagagccagcgaggag
acggtgagagccgggcagccttttaacatcacctgtgtcactccaaccggtctgggcttc
ctgcagcagtggctccatcctaaaaaacaggctgtgggtgcagttcagctgaaacagact
ttcccagactgggtcatctacaccctgagtatcccacatgccacctctcaggacagcggc
acgtacgagtgctccgtaacgcacgagttcagcagagaagtcagagtcagcagtgtgtcg
gtcaccgtcttcgaagagagttcctttgtggcgctggaccacagtgggattttagctacg
gagtcggtcaaccttttagaggagacagagtttaccatcctcattaatgcctacccgccc
cccaaagtgatgtggctgaaagacggcaaagccataccagagagctacttcgtcctcaca
aaaaccagccacctcgaagggaatcggtatcaaagcattctgacgttacgagaggctctg
gtgaaagacaacggggagtataccatcacagccaccagcggctctcgcactgctcagttc
tccttcaacctccaagtgaaagcccccaccgcaatgatgttcccaccatcctcagcccct
cagctgctgccaaatgtggaggagatggtggtgcccctccacacttctttcaccttgacc
tgtcggggagaggcaaaactagcctgggagacgccgtttgaaatgccggagaaaacacag
gaggacaacagcggcctgtttgtcaccaccatcactgtggacaatgccactgcaatgcac
actggctactacatatgcttctacagtagaaataccactgatgacacagaagacagcagc
atctacatctatgtgccagatccagatgctccctttgtgccatcgccggtgccttttggc
aaccacgtcctgtccgaccacgaggagatggagatccagtgtcgagtgtctgatcccagt
gctaacgtgaccctggttaacgttgacacccagcagcctgtgccgagtgtctatgacagc
aagaggggcgctttgggagtattcaccgctggaacctacgtctgtaaggctctcataaac
ggagaggaacactacagcggggaatacatcgtccacggctggacaggcgacgctgcgctg
cacgtcgagctgacggccaagcggaccgctctgctggtgggagacaccatcacagtcacc
tgtctggctcgtggatctgagattctggaagaccactggaaataccctggcaaagtggct
aatcgggctgtcaaaacagtgcatgagaacaagagggaccaggagatcctttacaccctg
acgatcccacaagcctcaaccaaggacagcggcatctactcttgctccatcactgatatt
atcagtaatgagagccagacaaagcaactagctattcaagtttttggaagtgagtttttg
accatctggcccaagttcggagaatatgaatcagctgaactggatgaggtgcgggagttc
aaggccgaaatcagctccttccccagcgctcatgttacttggctcaaagacggcatccca
ctcagcgacgtgacagcggagatctccaccagcctccggcaagtcagcgagaccagctac
atgagtgttcttacgctgatccgagccaaggaggaggacagcgggaactacaccatgcga
gtggagaatggagaccaaagacgcaatgttggattgatgctggaagtcaaagtgcctgca
gtcattgtggacctgatggacatccaccatggctcggcaacaggccagtctgtggtttgc
attacaagagggcagcccactcctgtggtggagtggttcgtctgcaagaacatcaaacat
tgtgccaatgactcgtcctcctgggtgcctctccccgccaactccacggagatctcaatg
gactcacactttgacgaagaaaataacctggagagccaagtcatgtttggtcatctggaa
aacacactggcagtgcgctgcctggccaggaatgaaatggccgctgtcagcagggaggtc
aagctggtgtctaatggccctcacccagagctgactgtagctgctgctgtgttggtgctg
ctggtcattgtcatcatctcactcattgtcttggttgttatctggaaacagaaaccacgg
tatgagatccgctggagggtcatagagtctgtgagcccagacggccatgagtacatctac
gtggatccgatgcagcttccctacgactccagatgggagttcccccgcgacaggctggtg
ctcggtcgtatcctcggctctggagcctttgggaaagtggtagagggcaccgcctatgga
ctcagccgctcccaacctgtcatgaaggtggcagtgaagatgctcaaacccacggcacgt
tccagtgaaaaacaagccctgatgtcagaactgaagatcatgactcatcttggacctcat
ctcaacatagttaacctcctgggagcgtgcaccaagtcaggccctatctacattattacg
gagtactgcttctacggggacctggtcaactacctgcacaagaacagggagaacttcctc
agcctgaatccagagaagaataataagaaagagctggacatctttggaatcaaccctgca
gacgagagcagcaggagctatgtcatcttgtccttcgagagcaaaggagactacatggat
atgaagcaggctgacaacactcagtatgtgcccatgctggagatgagcaacacctctaag
tactcagacatccaggggtctaactatgaccacccaccctctcagaaaggatcaaacgag
ggcgagatggacgacctgctgtcggacgacatgaacgagggcctcaccaccaccgacctg
ctcagttttacctaccaggtggccaaaggcatggagttcctggcttccaagaattgtgtg
catcgggatctcgccgccaggaacgtcctcctctctcagggcaagatagtgaagatctgt
gacttcggactggcccgagacatcatgcacgacaacaactacgtctccaaaggaagtact
ttcctgccagtaaagtggatggcaccggagagtatttttgacaacctgtacaccactctt
agtgatgtttggtcctacggcatcctgctctgggagatattctccttaggtggcaccccg
taccccgggatggtcgtggattcgagcttctacaacaagatcaagagcggatacaggatg
tccaaaccggagcacgcgccacatgacgtgtatgagatgatgatgaagtgctggaacagc
gaaccggagaagaggccttctttcctgggtctgagtgacaccgttgcttctttgctgccc
tccagctacaagagacattacgagagggtgaaccacgagttcctgaagagcgaccaccca
gccgtgactcgagtgtgcatggaaaacaacgacgcctacatcggcatcacctacaagaac
cagggcaagctgaaggacagggaaagtggcttcgacgagcagcggctgagctctgacagc
ggttacatcatccccctccctgacctggaccccatatctgatgatgaatatggaaagagg
aacagacacggctctcagacatcggaggagagcgccatcgagacgggctccagcagctcc
acttttgctaagcgggaaggtgagactctggaggacatcacgctgctggacgagatgtgt
ctggactgtagtgacctggtggaagacagctttctgtga

DBGET integrated database retrieval system