KEGG   Larimichthys crocea (large yellow croaker): 104919242Help
Entry
104919242         CDS       T04659                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00040  Pentose and glucuronate interconversions
lco00051  Fructose and mannose metabolism
lco01100  Metabolic pathways
Module
lco_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104919242 (sord)
   00051 Fructose and mannose metabolism
    104919242 (sord)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104919242 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C Methyltransf_16 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104919242
NCBI-ProteinID: XP_010729508
LinkDB All DBs
Position
VIII
AA seq 354 aa AA seqDB search
MAQENLSVVLHSKGDLRLENRPVPEPGPNEVLLQMHSVGICGSDVHYWQHGRIADFVVTK
PMVLGHEASGRVVKVGSAVKHLKVGDRVAIEPGVPREMDEFFKNGRYNLSPTIFFCATPP
DNGNLCRYYTHSANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSTVLICGAGPI
GLVCLLVAKAMGASKVVITDLSSERLTMAKELGADFQLTVKRGDVPQQLAKTVEDMLGTQ
PQITIECTGVESSIQTGIYATHAGGVVVLVGLGNEMATIPLINAAVREVDIRGVFRYCNT
WPMAIAMLASGKVNVKPLVTHRFPLEQAVQAFETTRQGLGIKVMLKCDQNDQKP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaaaatctctccgtggtgctgcactccaaaggagacctcaggctggaaaat
cgacccgtcccggagccaggacctaatgaggttttgctgcagatgcactctgttggaatc
tgtgggtcagatgttcactactggcagcacggccgaatcgctgactttgtggtcacgaaa
ccaatggtgctggggcacgaggcttcagggcgggtggtgaaggtcggatcagcagtcaag
cacctcaaagtaggtgatcgagtggctatagagcctggtgtgccccgcgaaatggacgag
ttcttcaaaaacggacgatataacttgtctcccactatcttcttctgtgccacgcccccc
gacaatggaaatctatgtcgatactacacgcacagtgccaacttctgctacaagttgcct
gataatgtgacatttgaggagggagctctaatcgaacctctgtctgtgggaatccacgcc
tgccgcagagcgggtgtaaccctcggtagcaccgtgctcatttgtggtgcaggacctatt
gggttggtctgtttgctcgtggccaaggcgatgggagcgtcaaaggtcgtcatcaccgat
ctctcctcagagcgtctaaccatggccaaagagttgggtgcagacttccagctgaccgtg
aagagaggagacgtaccccagcagttggccaagactgtagaggacatgctgggcactcag
cctcaaattactattgaatgcactggtgttgagagcagcattcaaactggcatctatgcg
acacatgcaggaggtgttgtggtgctggttggtcttggcaatgagatggccactattcct
ctgatcaatgctgctgtaagagaagtggacatcagaggggttttccgttactgcaatacc
tggccgatggccatagccatgttggcgtcgggtaaagtgaacgtcaagcccctcgtgacc
caccgcttccctctggagcaggcggtccaggcctttgagaccacgcgtcagggtcttggg
attaaggtcatgttaaagtgtgaccagaatgaccagaaaccctga

DBGET integrated database retrieval system