KEGG   Larimichthys crocea (large yellow croaker): 104920178Help
Entry
104920178         CDS       T04659                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00010  Glycolysis / Gluconeogenesis
lco00051  Fructose and mannose metabolism
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco00520  Amino sugar and nucleotide sugar metabolism
lco00524  Neomycin, kanamycin and gentamicin biosynthesis
lco01100  Metabolic pathways
lco01200  Carbon metabolism
lco04910  Insulin signaling pathway
Module
lco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104920178
   00051 Fructose and mannose metabolism
    104920178
   00052 Galactose metabolism
    104920178
   00500 Starch and sucrose metabolism
    104920178
   00520 Amino sugar and nucleotide sugar metabolism
    104920178
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104920178
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104920178
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lco04131]
    104920178
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104920178
Membrane trafficking [BR:lco04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104920178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104920178
NCBI-ProteinID: XP_010730655
UniProt: A0A0F8ACF1
LinkDB All DBs
Position
VIII
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMQQFRRELTKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESKIYDTPEDIIH
GSGTRLFDHVAECLGDFMEKQNIKDKKLPVGFTFSFPCQQTKLDEATLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRNIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSINPGKQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGKFETKHISAIEKSKEGLSKAREILTRLG
VEPSTDDCIAVQHVCTIVSFRSANLIAAVLAGILLRLKENKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQSRLIAQTLSEFRLS
TEQLLEVKKRMRTEIETGLSKSTQDSATVKMLPTFVQSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCQQTSLDAGILVTWTKGFKATDCEGENVVGLLREAIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNVEMIEGDEGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCEAVSRRAAQLCGAGMAA
VVDKIRENRGLNNLDITVGVDGTLYKLHPHFSGIMHQTVNELAPKCNVTFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccagctactagcctattacttcactgaactcaaggatgaccaggttaaa
aagatcgataagtacttgtactccatgcgtttctctgatgagacgttactggacatcatg
cagcaatttcggagggagttgaccaaaggactgggacgggacactaaccccactgctgcc
ctgaagatgctcccaacgtttgtgcgctctatccctgatggatcagagaagggcgacttc
attgcgttggatttaggaggcagtaacttcaggatcctccgtgtcaaagtcagccatgag
aagaaacagaccgttcaaatggagagtaaaatctatgacacaccagaggacatcattcat
ggcagtggaacaagactgttcgaccatgtggcagagtgtctcggtgactttatggaaaaa
caaaacatcaaagacaagaaacttccagtgggatttaccttctccttcccctgccagcag
accaaactagatgaggccactctactaacatggacaaagcgcttcaaggccagtggagtg
gagggcatggacgttgtcaagctgctcaacaaagctattaagaaacgaggagactatgat
gctgacatcatggcagtagtgaatgatactgtgggaacaatgatgacctgtggttttgat
gaccagcgctgtgaagttggcattatcatcggtactggtaccaatgcatgctacatggag
gagctgcgtaacattgacttggtggaaggagacgagggcaggatgtgtgtgaacactgaa
tggggagccttcggagacgatggcagactggaagacatcaggacagagtttgacagagag
atagaccgaggctctatcaaccccggcaagcagctatttgagaagatggtcagcggtatg
tacatgggggagctggttcgtctcattctcgtgaagatggccagagagggtctgctgttc
gaggggaggattacccctgaactgctcactaaggggaagtttgagaccaaacacatctca
gccatagaaaagagtaaggaggggttgtccaaggccagagagattttaaccagacttggt
gtggagccctcgactgacgactgcatcgctgtgcagcatgtttgcaccattgtgtctttc
cgctctgccaacctgattgctgctgtgctggcaggcatcctgttgaggctaaaggagaac
aagggcgtggcccgactccgaaccactgtaggcatcgacggatctctatacaagatgcac
ccacaatatgcccgtcgtcttcataagacagtccgtcgtttggtcccggactctgatgtc
cggttcctcctatcagagagcggcagtggaaaaggagcagccatggtgacagctgtggcc
taccgactcgctgaacaatcacgacttattgcccaaacactgtctgaattccgcctgtcg
accgaacagctgctggaggtgaagaagcgaatgaggacagagatcgaaactggcctttca
aagagcactcaggactctgccactgtcaaaatgctgccaacctttgtgcaaagcacgcct
gatggcacagagcatggtgacttcctggctttggatttaggtggaaccaacttcagagtt
ctgttggtcaagattcgttctggaaagaggagaacagtcgagatgcacaacaagatctac
gctattcctctggaagtgatgcagggcacaggagaggagttgttcgatcacattgtgcag
tgcatcagtgacttcctcgactacatggggatgaagaacgctcgtctacctctgggcttc
accttctcattcccctgccaacagaccagcctggacgctggaatccttgtgacatggacc
aaaggcttcaaggcaacagactgtgaaggagaaaatgtggtgggattgttgagggaagcc
attaagaggagagaggaatttgacctggatgtcgtggccatagtgaacgatacagtggga
accatgatgacctgcgcctatgaagaacccacctgtgagattggactcatcgctggcact
ggcagtaatgcgtgttacatggaggagatgaggaacgttgagatgatagagggagacgag
gggcggatgtgtgtcaacatggagtggggtgcttttggagacaatggatgcctcgacgac
attagaacagagtacgaccgcgctgtggatgacttctccctcaatccgggcaaacaaaga
tatgagaaaatgtgcagcggcatgtatcttggtgaaattgtgcggaacatcctgatagat
atgaccaagagaggattcctgttcagaggacagatttctgaaacactgaagaccagaggc
atctttgaaacaaagttcctctcacagatagagagtgacagactggctttgctgcaggtg
agatccatcctgcaacacttaggtttggacagcacctgtgatgacagtatcatagtcaaa
gaggtatgtgaagcagtgtcacgtcgtgcagctcagctgtgtggggcaggaatggcggcc
gtggttgataagattagagagaaccgaggactgaacaatttggacatcactgtaggggta
gacgggacgctctacaaactacatccacatttctccgggatcatgcaccagacagttaat
gaactggcccctaagtgtaacgtcaccttcctcttgtcagaggacggcagcgggaaagga
gctgcactcatcacggccgttggctgccggctgagacaggagctgaacaataaatag

DBGET integrated database retrieval system