KEGG   Larimichthys crocea (large yellow croaker): 104921009
Entry
104921009         CDS       T04659                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04012  ErbB signaling pathway
lco04068  FoxO signaling pathway
lco04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104921009 (cdkn1b)
   04068 FoxO signaling pathway
    104921009 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104921009 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104921009
NCBI-ProteinID: XP_019121343
LinkDB
Position
XXI
AA seq 200 aa
MSDVRLSNGSPTLERTDQQRVSDHPKPSACRSLFGSVDHEELNRDLKGHLREMEEAASAK
WGFDFANHKPLSNGRLEWELVDCRDVPDFYNGQTRRGENKKKQMKQKKKGVCSAGNNNVD
LNGNHSCVVVTPSEDSGRSDAQMECTEQCTGLRKRPACHDTSAQTKRSHTSSSSSDEVSC
PNLNHSAEHTPRKTSPKRQT
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtcagatgttcggttatcaaacgggagcccgacgctggagcgcacggaccagcagcgg
gtgtccgatcacccgaaaccgtccgcctgcaggagcctgttcggctcggtggatcacgaa
gagttaaacagggatttaaagggacatttgcgggagatggaagaggctgcctccgccaag
tggggcttcgacttcgccaatcacaagccgctgtccaacgggaggctcgagtgggaatta
gtggattgcagagacgtgccggatttctacaacgggcaaacgcgcaggggggagaacaag
aagaagcagatgaagcagaagaagaagggcgtctgctctgctgggaataacaatgtggat
ctaaacgggaatcatagctgtgtggtggtgacaccgagcgaagacagcggcaggtctgac
gcgcagatggagtgcacggagcagtgcaccgggctgaggaaaagacctgcatgccacgac
acctcggctcagactaagaggtcacacaccagcagcagcagctcagatgaggttagttgt
ccgaacctgaaccactctgcagaacacacacccagaaagacgagtcccaagaggcagacg
tga

DBGET integrated database retrieval system