KEGG   Larimichthys crocea (large yellow croaker): 104921377Help
Entry
104921377         CDS       T04659                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00350  Tyrosine metabolism
lco01100  Metabolic pathways
Module
lco_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104921377 (gstz1)
Enzymes [BR:lco01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104921377 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 104921377
NCBI-ProteinID: XP_019110298
LinkDB All DBs
Position
Un
AA seq 220 aa AA seqDB search
MHVSFVSLAKPVLHGYFRSSCSWRVRIAFALKGVEYDQAPVNLIKDGGQQLTQQYKAINP
MQQVPALEIDGITLSQSLAVIQYIDETRPGPRLLPADPKKRAQVRMISDLIASGIQPLQN
LYVIQKMGAEKMQWSQHFIDRGFQALEPILKQTAGKYCVGDEISMADICLVPQVYNAERF
KVDVDQYPTIKRLNQALLEIEAFKVSHPSRQPDTPADLRA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgtcctttgttagcctcgctaagcctgttcttcatgggtacttcaggagctcc
tgctcttggagggttcgcattgcttttgctcttaaaggtgttgaatatgaccaggctcca
gtcaatctaatcaaagatggaggtcagcagcttacacagcagtacaaggcaataaacccc
atgcaacaagtgccagcactggaaatagatggcatcaccctctctcagtcactggctgtg
atccagtacatcgatgagaccaggccgggacctcggcttcttccagcagacccaaagaaa
cgtgcccaggttcggatgataagtgacctcattgcctccgggatacagcctctgcagaat
ttgtacgtgattcagaaaatgggagcagaaaagatgcagtggtctcagcacttcattgac
cgtggcttccaagctcttgagcccatcctgaagcaaacagcagggaaatattgtgtagga
gatgagatatccatggcagacatctgtctggtcccacaagtctacaatgcagaaaggttc
aaagtggacgttgaccagtatccaactatcaaaaggttaaatcaagccttacttgagatt
gaagctttcaaagtgagccacccgtctcgccaaccagacacacctgctgatctgcgtgcg
taa

DBGET integrated database retrieval system