KEGG   Larimichthys crocea (large yellow croaker): 104921828Help
Entry
104921828         CDS       T04659                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00590  Arachidonic acid metabolism
lco01100  Metabolic pathways
lco04370  VEGF signaling pathway
lco04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104921828 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104921828 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104921828 (ptgs2)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104921828 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 104921828
NCBI-ProteinID: XP_010732791
UniProt: A0A0F8AM75
LinkDB All DBs
Position
Un
AA seq 608 aa AA seqDB search
MNKLTFVVFLLALGFLVCEAGNPCCAGPCQNRGVCTALGADNYECDCTRTGYSGQNCTTP
EFLTWLKITLKPSPNTVHYLLTHFKGFWNIVNNISFLRDAIMRYVLTSRSHMIDSPSTYN
ADYGYLNWEAYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKVLAEKLLVRRQFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKKGPAFTLSKGHGVDLSHIYGDNLERQHKLRLFKDGK
LKYQIVDGEVYPPTVQEVGVDMHYPPHVPDSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNQRF
QYQNRISSEFNTLYHWHPLMPDSFHIEEKDYSYKQFVFNNSVVTEHGISNLVESFSKQVA
GRVAGGRNVPGPILYVAIKSIENSRKMRYQSLNAYRKRFSMKPYTSFEDMTGEKEMAAVL
EEMYGHIDAVELYPGLLVEKPRENAIFGETMVEMGAPYSLKGLLGNPICSPEYWKPSTFG
GSVGFNIVNTASLQKLVCSNVQGPCPIASFHVPDAPTTGSMIINSSTSHSRRSDINPTVI
LKERTTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactcacatttgtggttttcctcttggcactgggttttcttgtctgcgaagct
ggtaacccatgttgcgccggaccatgccagaacaggggcgtttgcacagcgcttggggca
gataattatgagtgtgattgcacacgcacaggatattctggacaaaactgcacaacacct
gagttcctcacctggctcaaaattaccctgaagccgtcccccaacacagtccactacctt
ctcacccacttcaagggcttctggaacatcgtcaacaacatctcatttcttagggatgct
atcatgagatatgtgctgacatcccgatcccacatgattgatagtccttccacttataat
gcggattatggttacttgaactgggaagcctattccaacctttcctactatacacgcacc
ctcccccctgtgcctgaagattgtccaacccctatgggagtagtaggtaaaaaggagctg
cctgatgctaaggtactggctgagaaacttctggtgagaagacagtttatcccggaccca
cagggaaccagcctgatgttcgcattcttcgcacaacatttcacccaccagttcttcaaa
tctgacatgaagaaaggacctgcttttaccctatctaaaggtcacggggtggatcttagc
cacatttatggtgacaacctggaaaggcaacacaagcttcgacttttcaaggatggcaag
cttaaatatcagatcgtagatggagaagtgtaccccccaacagtacaggaagttggtgtt
gacatgcactaccctcctcatgtccctgactctcaccgcttcgctgtgggtcacgaggct
ttcggcctggtccccggtctgatgatgtatgccaccatctggctgcgggaacacaaccgg
gtgtgtgatgtgttgaaggaggttcaccctgactgggatgacgaaaggctcttccagacc
acacgactcattctgattggagagaccatcaagattgtgatcgaggactacgtgcagcac
ctgagtggctataacttcaagctcaaatttgacccagaactgctgttcaaccagcgcttc
cagtaccagaaccgcatctcatccgagttcaacaccctttaccactggcacccactgatg
cctgattctttccacattgaggagaaagattacagctataagcagtttgttttcaacaac
tctgtagtgactgagcatggcatcagcaaccttgtcgagtcgttttccaagcaagttgct
ggacgggttgctggtggtcgaaatgtcccaggacctatcttgtatgtggccattaagtcc
attgaaaacagccgcaaaatgcgctaccagtccctgaatgcctacaggaaacgattctcc
atgaagccctacacctcttttgaagacatgacaggagagaaagagatggccgcagtgctc
gaggagatgtacggacacattgacgctgtggagctctacccaggtcttttggtagagaaa
cccagagaaaacgccatctttggggaaaccatggtggagatgggggcaccttattccctc
aaaggcttattgggaaaccccatctgctccccagagtactggaagcccagcacattcgga
ggcagcgtcggcttcaacattgtcaacaccgcctccctgcagaaacttgtctgcagtaat
gtccagggcccctgtcctattgcatcttttcacgtgcctgatgccccaacgacagggtcc
atgatcatcaactcaagcacatctcactcacgcagaagtgacatcaaccccacggtcatt
ctgaaagaaaggactactgagctctaa

DBGET integrated database retrieval system