KEGG   Larimichthys crocea (large yellow croaker): 104921882Help
Entry
104921882         CDS       T04659                                 

Gene name
ret
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104921882 (ret)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104921882 (ret)
Protein kinases [BR:lco01001]
 Receptor tyrosine kinases (RTK)
  RET family
   104921882 (ret)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD3 RET_CLD1 RET_CLD4 Pkinase Cadherin Pkinase_fungal Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 104921882
NCBI-ProteinID: XP_010732854
LinkDB All DBs
Position
Unknown
AA seq 1111 aa AA seqDB search
MGSSCGFSRGNIVVVVLLLLLLDGATGLYFPQNEYIETVYVGQQAGTPILQVHAMLDSDS
ERPHFYLCWTISHRHPYSSWFNLDINTGILSLNKTLEESDFALLNQKSPFVMKLSLKAMV
LPYFTKKPQCNSRSFFRITLDFVNATMPQCAQTDMKELCFPHRDTSNPHIMENRFPGPLR
QLRRLTRLNVCPNYTISYNVDPDTPAPFAVNENTTELVVTAPLDREESERYRLLLVCTVR
TETVITKVETSLDVFVNDEDDNAPYVNGTDTADIIISFNRTKGGSFGTLFIFDRDLTPIY
PIDQSHNKYVGTLLNSDPWVKETFAIKGTFSEKKAALGGIRMTVHDYQLVLKRNLYVTEN
RTLQLDYLVNDTTYPGLEGTVLLHFNVTILPVHIRFPNITHMFTLTRRASVYAQVGRVCV
ENCQQFDGISVTYRLEVPDKNVSADMQTCYSAISITQAPDEMWGLLYVNDTEALHRPECQ
DLQYLVVAQEEHTQLEASTQIHIILDSEANKASQENQQFLSCAENRRRGDCESVRGLGAT
TGRCQWRQGSEKGISENYSTCSPDLRTCPDSFCDAVESKDASICPQDCTKETVTGGHERG
LRNGIQAGYGTCYCYSERCFCEKEDIEEPICDDMCKTIIATALLLSFIVSILLSSYFIHR
YHKNSPKPPIASAEMTFRRPAQAYPISFPANNLRRGSQESIETDTFKIPEDPKWEFPRKN
LVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHSELRDLLSEFTLLKQVN
HPHVIKMYGACSQDGPLYLIVEYAKYGSLRNFLRESRKVGPSYMGRDANRNSSYLENPDD
RALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEED
SYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNL
LKTGYRMERPENCSEEMYNLMLRCWKQESDKRPTFSDISKELEKMMVKSRDYLDLAASTP
ADALLYDDALSEEDTPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEKSPVPLNRHDAT
NPVFTRYANDSVYANWMALPSPAKAVDKLDS
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atggggtcaagttgtggtttctctcggggaaacatcgttgtggtggtgctgctgctgctg
ctgctggacggagcgacagggctgtacttccctcagaatgagtacattgagacagtgtat
gttggccagcaggcagggacgccgatcctccaggtccacgccatgctggatagtgactct
gagcggccgcatttctacctgtgctggacaatctctcacagacatccctacagctcctgg
ttcaaccttgacatcaacactggaatactgtctctgaacaaaaccctggaggagagtgac
ttcgccttgctaaatcaaaagtcaccgtttgtgatgaagttgtccctgaaagccatggtg
ttaccttactttaccaagaagccccagtgcaatagcagaagcttctttcggatcaccctg
gactttgtcaatgccacaatgccgcagtgtgctcagacagatatgaaggaactatgcttc
ccgcacagagacacctccaacccccacatcatggagaacaggttccctggacccctacgg
caactccgacgtctcaccagactcaacgtctgccccaactacaccatctcttacaatgtg
gacccagataccccagcaccatttgctgtcaatgagaacaccacagagctggtggtgact
gctccgttggaccgcgaggagagtgagcgctacagactgctgctggtttgcacagtccgg
acagaaacggtcatcaccaaggtggaaacttcactggatgtttttgtcaatgacgaggac
gataacgcaccatatgtgaatggaacagacacagcagatattattatcagctttaaccgg
acgaagggtggttcctttggaactttgttcatctttgacagggatctaacccccatctac
cccatagaccagagtcacaataaatatgtggggaccttgctcaatagtgacccatgggta
aaggagacatttgccataaaaggcaccttcagtgaaaagaaagctgctcttgggggcatt
cgaatgaccgttcacgactaccagcttgtcctgaagaggaacctgtatgtgactgagaat
cgcaccctgcagctggactacctggtcaatgacaccacctaccccggcctagagggaaca
gtgttgttgcacttcaacgtcactatcttaccagtccacatccgcttccccaacatcaca
catatgttcacattgacacggagagcttctgtttatgcacaggttggcagagtctgtgtg
gaaaactgccagcagttcgatggcatcagtgtcacataccggctcgaggtgccagataag
aacgtgtctgctgacatgcagacttgctactcagccataagcatcacccaggcaccagac
gagatgtgggggctgctctatgtgaacgacacagaggcgctacataggcctgagtgccag
gacctgcagtaccttgttgtagctcaggaggagcacacacagctagaggccagcacacag
atccacatcatactagacagtgaagcaaacaaggccagtcaagagaaccagcagttcctg
tcatgtgcagaaaacagacggcgaggagactgtgagtctgttcgaggcctgggggcaaca
acggggagatgccagtggaggcaaggcagtgaaaaaggaatatctgaaaattactccacc
tgctcgcctgacctgcggacgtgtccagatagcttttgtgacgcagttgaaagcaaagat
gcatcaatatgcccacaagactgtacgaaggaaactgtcactggaggtcatgaacgaggt
ttgaggaatggaattcaggctggatatggaacctgctactgctactctgagaggtgtttc
tgtgagaaggaagatattgaggagcccatatgtgacgacatgtgtaagaccatcatcgcc
acagctctgctcctctccttcatcgtctccatcctcctgtcctcatacttcatccaccga
taccacaagaactcacccaagcccccgatcgcctctgctgagatgactttccgaaggcca
gctcaggcttaccccatcagcttccctgctaacaatttacgccggggctcgcaggaatcc
attgagacggacacctttaaaatacctgaggatcctaagtgggagtttcctcgtaaaaac
cttgtacttggcaagactttaggagaaggggagtttgggaaagttgtcaaagcaacagca
ttcaggctgaaaggaaaagctggttacaccactgtggctgtgaaaatgcttaaagaaaat
gcctcccacagtgagctgcgagaccttctgtcagaatttactttactgaagcaagtcaac
catccacacgtcataaagatgtatggagcatgcagccaagacggtccattgtatctgatc
gtggaatatgccaagtatgggtcacttcgcaacttcctgcgagagagtcggaaagttggc
ccaagctacatgggcagggacgccaacagaaactccagctacttggagaacccagacgac
agggcactcaccatgggcgacctgatctcttttgcgtggcagatctccagagggatgcaa
tacctggctgaaatgaagctcgttcacagggaccttgcagctcggaatgtccttgtagct
gaaggacgaaagatgaagatctcagactttggcctttccagagatgtgtatgaagaggac
tcatatgttaagaggagcaagggccgtatacctgttaaatggatggcaatagagtcgttg
tttgatcacatttacacaacacaaagtgacgtctggtcctttggtgtgctgttatgggag
attgtgacactgggaggaaatccatacccaggtatcgctcctgaacgcctctttaaccta
ctcaagactggctacaggatggaaagaccagagaactgctcggaggaaatgtataacctc
atgctccgatgctggaaacaagaatcagacaagaggccaacattctcagatatcagcaaa
gagctggaaaagatgatggtgaaaagtcgggattacctggacctggctgcgtccacgcca
gctgatgccttgctgtatgacgacgccctctctgaagaggacactccactagtggactgt
aataacgcccctctccctcgaaccctcccctccacatggattgaaaacaagctctatggc
atgtcatacccgaactggcctgagaagagcccggtaccgctcaacagacatgatgccact
aatccagtctttacaagatatgccaatgatagtgtttatgcaaactggatggctttgcct
tcacccgcaaaagctgtggacaagcttgatagctaa

DBGET integrated database retrieval system