KEGG   Larimichthys crocea (large yellow croaker): 104923921Help
Entry
104923921         CDS       T04659                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04210  Apoptosis
lco04625  C-type lectin receptor signaling pathway
lco04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104923921
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104923921
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104923921
   04672 Intestinal immune network for IgA production
    104923921
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104923921
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104923921
Protein kinases [BR:lco01001]
 Serine/threonine kinases: STE group
  Other
   104923921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like CCDC106 APH SR-25
Motif
Other DBs
NCBI-GeneID: 104923921
NCBI-ProteinID: XP_010735425
LinkDB All DBs
Position
Un
AA seq 855 aa AA seqDB search
MAVRQRIFNSTSPFSGSSPAELKGSYPSCSAADQETEEEEEEGKDSKMGYIAYNNPMINK
VLTHGTAEQVGKMPLKTSPFIAQAECETQVEFSPSCSERSFSSHYINSPSLEHNNVACQT
TASIQEPSGSAQHAPRKKNRKRQKRKGKKKLEKKKEKQRYRHRMPSGVPEQESGSSLVQI
LEPSSLGGRGDLSTSCCSSVESSEEQDRGPSLYGRQAYITGSSCSPLNWRDEVCGPLSSL
HSYGQDSDSDCLSSLGDYSLALAGLRGSVSQGDPCYALPFVKDVERDVREEEYELSAADS
LGNEGIIFYNEKIQPVDSEYREGREYVLTQFVKEGSYGEVHGARDVNTGFNFAVKKIALK
RFSSEEVGAWSALRSPRVVELFGVVREGPNVLLFMDQKSGSLGQLIADCGRLPEDLSLHY
HSQVLAALEHLVKKKVVHLDIKADNVLLSEDGRDTFLCDFGHAERLDNQGQSLSGSKDLK
GSETHMAPEIVKGEPRGAKADVWSSCCMLLHMLNGCQPWTRYYTCRLYLKIANEPPPLRE
IPPDCSPLTAEVIKVGLQKDPAKRASASDLKEKTARALKEVGGLTSPVKGPYTEPLYFAE
KPPDSLQLISSSVDYEDEEEHQESVDKVITAGRKTRDLGDDDEEKEAESKRGSPFCPQTL
ISELSHKRGNKITTVPELELRKLERDFYQSTLSQLHPAEMQEQLLSCLSSDPYTNWEPWD
KKDSGRWSLSPGDEFSSGVFSYDSQPDVQVVNVDLLNHTQLPSPCCFEGVDVCIRDFNRK
SIHIREARRVKVGHIATGISYQIPERVFTLETQQGQQVAHDEEVLESGLELCCVPAPDFS
SAWRWRIRDSVLETR
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcagaggatttttaactcaacatcaccgttctccgggtcctccccggct
gagctgaaggggtcatacccatcctgctcagctgcagaccaggagacagaggaggaggaa
gaggagggaaaggacagcaaaatgggctacatagcctataataaccctatgataaataag
gtcctgacacatgggactgcagagcaagtggggaaaatgccactgaagacctcacccttc
attgcccaagctgaatgtgaaacccaggtggaatttagtccatcctgttccgaacgttcc
ttctcctcccactacatcaacagcccttccttagagcacaacaatgtggcatgccaaaca
acagcgtccatccaagagccgagcggctcggcacaacatgcccctagaaagaagaacagg
aagagacagaagcgcaaagggaagaaaaaacttgaaaagaagaaggagaagcagcgatac
agacatcggatgccctctggagtccctgaacaggagagtggaagttctctggtccagatc
ctggagccgtcgtctcttggaggccgaggagacctcagtacttcttgctgtagcagcgtt
gaaagctcagaagagcaggacagagggccttctctttacggccgacaggcctacatcacc
ggttccagctgctctcctctgaactggagggacgaagtctgcggccccctctccagtctc
cattcctacgggcaggacagcgactcagactgcctcagcagtctgggagattattcgctg
gcccttgctggtctcaggggcagcgtcagtcagggggacccatgctatgcattgcccttt
gtcaaagatgtggagagggatgtcagagaagaggagtatgagctctcagcagctgattct
cttggcaacgagggaatcatcttttacaatgaaaaaatccagcctgtggactcagaatac
agggaagggagggagtatgtcctcacacagtttgtgaaggaaggctcctatggtgaagta
cacggtgctcgagatgtcaacacaggcttcaattttgctgtcaaaaagatcgccttgaag
aggtttagcagtgaggaggtgggtgcgtggagtgccctcagatctcctcgtgtggtggaa
ctctttggcgtggtcagagaggggcctaacgtcctccttttcatggaccaaaaatctggc
tctctgggccagctgatagcagactgtggccggctgccagaggacctaagcctccactac
cactcgcaagtcttagcagcgctggagcacttagtgaagaaaaaagtggtgcatctagac
atcaaagctgacaatgtgttgctgtcggaggacggtagagacaccttcctgtgtgacttc
ggacatgcagagagacttgacaatcagggacagagcctgagtgggtccaaagatctcaag
ggctcagagacccacatggcccctgagattgtaaaaggggaaccccgcggagccaaagca
gatgtgtggagcagctgctgtatgttactgcacatgctgaatgggtgtcaaccttggaca
agatactacacctgcagactttacctgaagattgctaacgagcctccgcctctgagagag
attccacccgactgcagccccctcacggctgaagttatcaaggtgggacttcagaaggat
ccagccaagagagcatcagcatctgacctcaaagaaaaaactgccagagctctgaaagaa
gtgggaggactcaccagcccagtgaaggggccctacacagagcccctctattttgccgaa
aaacctccggactccctacaacttatcagtagcagtgttgactatgaggatgaggaggaa
catcaagagtctgttgacaaagtgatcacagcagggaggaagacaagggacctgggcgac
gacgatgaagagaaggaggccgagtcaaagcgaggctcgcctttctgtccacaaacgctg
atctctgagctgagccacaagaggggcaacaagatcaccactgtgcctgaactcgagcta
cgtaaactggagagagatttctaccagagcactctgtcccagcttcaccctgctgagatg
caggagcagctcttgtcttgtctcagcagtgacccgtataccaactgggaaccatgggac
aaaaaggactctggtcgctggtctctgagcccaggagacgaattcagctctggcgtcttc
tcctacgacagtcagccagatgtgcaggttgtcaatgtggatttgctgaatcacacacag
ctaccatcgccctgctgtttcgaaggggtggatgtctgcatcagagacttcaacaggaaa
agcattcacatcagagaggcgcgccgggtgaaagtgggccacattgccactggaatcagt
tatcagatccctgagagggttttcactttggaaacccagcagggccagcaggtcgctcac
gatgaggaggtgctggagtccggtctcgagctctgctgtgttcctgctccagacttcagc
tctgcctggaggtggaggatcagagacagcgtgctggagacgagatag

DBGET integrated database retrieval system