KEGG   Larimichthys crocea (large yellow croaker): 104924699Help
Entry
104924699         CDS       T04659                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00010  Glycolysis / Gluconeogenesis
lco00030  Pentose phosphate pathway
lco00051  Fructose and mannose metabolism
lco00052  Galactose metabolism
lco01100  Metabolic pathways
lco01200  Carbon metabolism
lco01230  Biosynthesis of amino acids
lco03018  RNA degradation
Module
lco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104924699
   00030 Pentose phosphate pathway
    104924699
   00051 Fructose and mannose metabolism
    104924699
   00052 Galactose metabolism
    104924699
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104924699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lco01009]
    104924699
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lco03019]
    104924699
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104924699
Protein phosphatases and associated proteins [BR:lco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104924699
Messenger RNA biogenesis [BR:lco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104924699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 104924699
NCBI-ProteinID: XP_010736434
LinkDB All DBs
Position
XXIII
AA seq 790 aa AA seqDB search
MAQPDSKKIFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGLYVGAKVYFIHEGYQG
MVDGGENIKEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLKAAHNLVQHGITNLCVIG
GDGSLTGANLFREEWSGLLGELVEQGSIEADAVQKYSALHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEDKMCQKLSANRAGMKRLNIIIVAEGAIDHNNKPITTEYIKNLVVKCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRLPLMECVQMTQE
VQKAMDEKRFEEAVKLRGRSFENNLKTYKLLAHRKLESELPTSNFNVAVLNVGAPAAGMN
AAVRSAVRVGISEGHKMFAVSDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAK
HVDKIAEQMRAHNINALLIVGGFEAFESLLQLYEARATYEEFCIPMCMLPATISNNVPGT
DLSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAAYIY
EEPFDIRDLQANVEHLTEKMKGSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDSRK
NVLGHMQQGGAPSPFDRNFGTKISAKAMQWVTKKLVETFRQDEGRVFANTEDSCCLLGMR
RRALVFQPVVQLKDQTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVRNR
PKESDASVAM
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccggacagcaagaagatcttctttgagaacctgtcgggagcggggaaagct
atcgcggtgctgacgagcggaggagatgctcaagggatgaatgctgctgtacgtgccgtg
gttcgaatggggttatatgtgggagcaaaagtttatttcattcatgagggatatcagggt
atggtggacggtggagagaacataaaagaggcctcatgggaaagtgtctccagcatgctg
caagtgggtggcaccgtgatcggcagcgcccgctgtaaagagttccgcagccacgaggga
cgcctgaaggcagctcacaacctggtgcagcacggcatcaccaacctgtgcgtgatcggt
ggagatggaagtctgacgggcgccaacctcttcagggaggaatggagtgggctgctggga
gagctggtggagcaaggctcaatcgaagccgatgccgttcagaagtattcggcccttcac
atcgtggggatggtcggctccattgacaacgacttctgtggaactgacatgacaatcggt
accgactctgccctgcacagaatcatcgaggtggtagacgcaattatgacgactgcacag
agtcaccagagaacatttgtgttagaggtcatgggcagacactgtggctacctggccttg
gtgagtgccctggcttgtggggcagactgggtgctgattcctgagatgcccccagaggat
ggctgggaggacaagatgtgtcaaaaactgtctgcgaaccgagcagggatgaaaaggctg
aatatcataattgtagccgaaggggccattgatcataacaacaagcccattaccactgaa
tatatcaagaatcttgttgtgaaatgcttgggttttgacacacgagtgacaatcctgggg
catgtgcagagaggagggaccccgtctgctttcgaccgcatcctggccagccgtatgggt
gtggaggctgttcttgcccttctggagaccacagctaacacaccagcctgtgtggtgtct
ctgtgcggcaaccagtcggtgcgcttgcccctgatggagtgtgtgcagatgactcaagag
gtccagaaggccatggacgagaaacgctttgaggaggcagtgaagcttcggggcaggagc
ttcgaaaacaacctgaagacatacaaactcctggctcatcgtaaactggaatccgaactg
cctactagcaacttcaatgtggcagtgttgaatgtcggcgctcctgcagcaggaatgaat
gctgctgtgcgttcagccgtcagggtgggcatctctgaggggcacaagatgtttgctgtc
agtgatggctttgagggcttctacaaaggacagattaaggagattaaatgggccgatgtg
ggaggatggacaggacagggtggatctctgttgggaaccaaaagaacacttcccgcaaag
catgtcgacaaaatcgctgagcagatgcgagcacataacattaacgctctgctcattgtt
ggtggatttgaggcgtttgaaagtctgctgcagctgtatgaggctcgcgctacctatgag
gagttttgcatcccgatgtgtatgctgcctgccaccataagtaacaatgtaccgggcaca
gatctaagtatcggggcagacacggccctcaatgccatcgtggagacttgtgaccgcatc
aagcagtcggcaagcggcaccaagagacgcgtgtttatcatcgagaccatggggggctac
tgtggatatctggccagcgtgggaggcctggctgctggagccgatgccgcctacatctat
gaggagccttttgacatcagagacctgcaggccaatgttgaacatttgacagagaaaatg
aaggggagcattcaaagaggactggtactcaggaatgagaactgtaatgagaactacaca
acagacttcatctaccagctctactctgaagaagggaagggagtgtttgactcgaggaag
aatgtgctgggacacatgcagcagggaggagcaccgtctccatttgaccgcaactttggg
accaagatctccgccaaggcgatgcagtgggtgaccaaaaagctggtggagaccttcaga
caggatgaaggccgagtgtttgctaacactgaagactcgtgctgtctgctggggatgcgt
cgcagggctctggtcttccagcctgttgtacaactcaaggatcagactgactttgttcac
aggatcccaaaggagcagtggtggttgaagctgcgtcctctgatgaagatcctggccaag
tacaagacgagctacgacgtctcagactctggacagctggagcacgtcgtacgcaaccga
cccaaagagtcggatgcctcagtagccatgtga

DBGET integrated database retrieval system