KEGG   Larimichthys crocea (large yellow croaker): 104925134
Entry
104925134         CDS       T04659                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lco  Larimichthys crocea (large yellow croaker)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 104925134
NCBI-ProteinID: XP_019118027
LinkDB
Position
VI
AA seq 358 aa
MSKCELIELKDLSVNDPIELAPPATRKVPPPVNPVQPGHFHVVRMVGDSVTIEAPWCQTR
EAAVGHDFQPYSYTHLTWCDLCGEFIWGVYKQSLRCANCSYTCHYRCRLFIQLDCSTDGS
LLADQEDYSVDSIETDTNVDEQIDLGKRKLTVSEIQHKIKEYNAQINTNLNMVINKDGSY
TGFIKVHFSLVRPISLPPRQSLCSTQEENQHSRQINRRTSFYLPKDTAKHLHISSQTRVR
EVIEALLNKFTVVDNPAKFALFERTERQSQVYMRKLSDDECPLYLRLCAGPSEKVLSLVL
KENETGEVNWDAFSFPELCNFLRILKREEEAHVRQIVKRYTLARDMMKQAIARVSTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgattgaactgaaagacctcagtgtaaatgatccaattgagctg
gctcctcctgcgacacgcaaagtcccaccgcctgtaaacccggttcagccaggccacttc
catgtcgtccgtatggttggagacagcgtcaccatcgaggcaccctggtgtcagacaaga
gaggcggcagtgggtcatgacttccagccctatagttacacccatctcacctggtgtgac
ctgtgtggagaattcatctggggtgtttataagcaaagtttacgctgtgccaactgcagt
tatacttgtcactaccgctgccgactgttcatccagctggactgcagcacagatggaagt
ttgttagcagaccaggaagattactcagtcgactccatcgagacagacacaaatgtggat
gaacagattgatttgggtaaacggaagttgactgtcagtgagattcaacacaagattaag
gagtataatgcacagatcaacaccaatctcaacatggtgattaataaagacgggtcttac
actggtttcatcaaagtccacttcagcttagtccgtcctatctccctgcctccacgtcag
agtctgtgctccacacaggaggagaaccagcacagcaggcagataaatcggcggacatct
ttctacctccccaaagatactgccaagcacctgcatataagctcccaaacacgtgtgcga
gaagtcatcgaggcgctgctgaacaagttcacagtggtggacaacccagctaagtttgca
ctgtttgaacgcaccgagagacaaagtcaagtgtacatgcgtaaactgtccgatgatgag
tgccccctctacctgcgtctgtgtgctggccccagtgaaaaagtcttgagtctggttttg
aaagagaatgagacaggggaagtaaattgggacgcatttagttttcctgagctgtgcaac
tttctgcgaatcctgaagcgtgaggaagaagcgcatgtacggcagattgtgaagcgctac
actcttgctagagacatgatgaagcaggccatcgcgagggtctctacccctggttga

DBGET integrated database retrieval system