KEGG   Larimichthys crocea (large yellow croaker): 104925957
Entry
104925957         CDS       T04659                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04068  FoxO signaling pathway
lco04217  Necroptosis
lco04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104925957 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104925957 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104925957 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104925957 (stat3)
Transcription factors [BR:lco03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104925957 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 104925957
NCBI-ProteinID: XP_010738018
LinkDB
Position
XII
AA seq 785 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SAAQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERALLS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRPEAAPEPEIGGDPTGIIQPYLKTKFICVTPC
PSVFMDLPDSCELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGHLDSLTLDMD
VASPM
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtatctggagcaactgtaccac
ttgtacagtgacagcttccccatggagctacggcagttccttgccccctggattgagagc
caggactgggcttatgctgccaataaggagtcacacgccacactggtgttccacaacctc
ttgggggaaatagatcagcagtacagccgcttcctgcaggagaataatgtactctaccag
cataacctgcgccgaattaaacagcatctgcagagcaagtacttggagaagccgatggat
attgcccgcattgttgcccgttgtctttgggaggagcaaagactgctgcagactgccacc
tctgctgcacaggatggccaggcagcacatcccactgggacggtagtgacagagaagcag
cagatcctggaacacaaccttcaggacatcaggaagcgggtgcaggacatggaacagaag
atgaaaatgcttgagaacttgcaggatgactttgacttcaattacaagacattgaaaagc
caaggagagttgtcccaggacctaaatgggaatagccaagcagctgctaccagacagaag
atggctcagcttgagcagatgctgagtgccctggaccaactcaggaggcaaattgtgaca
gagatgggaggcctgctgactgccatggattatgttcagaagaacctgacagatgaagaa
ctagcagactggaagagacggcagcaaattgcctgcattggaggtccacctaacatctgc
ctggaccgccttgaaacatggatcacgtccttggctgagtcccagctccagattcgtcag
cagatcaagaagctggaggagcttcagcagaaggtatcctacaaaggagaccccatcatc
cagcaccggcccgccctggaggagaagatagtggacttgttcagaaacctgatgaagagt
gcttttgtggtggaaagacagccttgtatgcccatgcatccagacagacctctggtcata
aaaacaggagtgcagttcacaaataaagtcaggttactggtgaagtttcctgaactcaat
taccagctgaaaattaaagtctgcattgacaaggaatctggagatgtggctgcaattcga
gggtcaagaaagtttaacatcctcggtaccaacacaaaagttatgaacatggaggaatcc
aacaatggcagcctgtcagcagagtttaaacacttgaccctgagagaacaaaggtgtggt
aacggtggccggaccaatagtgatgcctctctgattgtcacagaggagctccatcttatc
acttttgagacagaagtctaccaccaaggcctgaagatcgatctggagactcattccctg
cctgtggtcgtcatttcaaacatctgccagatgcccaatgcctgggcctccattctgtgg
tacaacatgctcactaaccacccaaagaatgtgaacttcttcaccaagcctcctgtgggg
acgtgggaccaagtggcagaggtcctaagctggcagttttcctccactaccaaaagaggc
ctgaccattgaacaactcaccacactggctgagaaattactagggccttgtgtcaactac
tctggctgtcagatcacttgggccaagttctgtaaggaaaacatggctggcaaaggcttc
tccttctgggtgtggttggacaacatcattgacctggtgaagaagtatatcctggcactg
tggaatgaagggtacatcatgggttttatcagtaaggagagggagagggcccttctgagt
ccaaaacctcccggcactttcctgttgcgcttcagtgagagcagcaaggaggggggcatt
acgtttacgtgggtggagaaagacatcagcggaaaaacccagatccagtctgtggagcct
tacaccaagcagcagctcaacagcatgtctttcgctgacatcatcatgggctacaagatt
atggatgcaaccaacatcctggtttcaccgctcgtgtacctctatcctgaaatccccaaa
gaggaagctttcggcaaatactgcaggccagaagcagctcctgagcctgagattggagga
gacccgacgggtattattcaaccatacctgaagacaaagtttatctgcgttaccccgtgt
ccctctgtgttcatggacttgccggacagctgtgagctgcttgggaacggattcccaggc
actaactctggaaataccagtgacctgttccccatgtcgcctcgcaccctcgactccctg
atgcacaatgaagctgaagccaatccaggacatttggattcgctcactttggacatggac
gtagcatcgcctatgtag

DBGET integrated database retrieval system