KEGG   Larimichthys crocea (large yellow croaker): 104926159Help
Entry
104926159         CDS       T04659                                 

Definition
(RefSeq) tyrosine-protein kinase yes
  KO
K05705  tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104926159
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104926159
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lco04131]
    104926159
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104926159
Protein kinases [BR:lco01001]
 Non-receptor tyrosine kinases
  SRC family
   104926159
Membrane trafficking [BR:lco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    104926159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 SH3_10 zf-RING_14 RIO1 APH
Motif
Other DBs
NCBI-GeneID: 104926159
NCBI-ProteinID: XP_019113096
LinkDB All DBs
Position
II
AA seq 547 aa AA seqDB search
MGCVRSKEDKGPALKYRPDNPNATPVNSHLGHYGPDPTLMGHSPAMKTHNNSYNSHAAAL
TPFGGASSVMTPFGGASTSFTSVAVSSPFPGVITGGVTFFVALYDYEARTSDDLSFKKGD
RFQIINNTEGDWWEARSINTGQKGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLLPG
NQRGTFLARESETTKGAYSLSIRDWDEMKGDNVKHYKIRKLDNGGYYITTRAQFETLQKL
VKHYTEHADGLCYRLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTW
NGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMGKGSL
LDFLKEGDGKYLKLPQLVDMAAQIADGMAFIERMNYIHRDLRAANILVADNLVCKIADFG
LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGM
VNREVLEQVERGYRMPCPQGCPESLHEMMRHCWKKEPDERPTFEYIQSFLEDYFTATEPQ
YQPGDNL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgggttgcgtcaggagtaaagaagacaagggcccggcgctgaagtacagacccgataac
ccgaatgccacgccggtcaactcccacttaggccactacgggcctgaccccaccctgatg
ggtcattcgccggctatgaagacacacaacaacagctataacagccacgccgccgccctc
acgcccttcggtggggcgtcttcggttatgacgcccttcggcggggcctccacctccttc
acttcagtggccgtgagcagtccgttccccggtgtcatcacaggtggcgtaacatttttc
gtagcgctgtacgactacgaagcgaggacgtcggatgatctgtcgttcaaaaaaggggat
cgcttccagattatcaacaacacggagggcgactggtgggaggctcgctccattaacacc
ggacagaaaggttacatccccagtaactacgtggctccagccgactccatacaggctgaa
gaatggtactttggtaaaatgggccgcaaagatgctgagcgtctcttattgcttccaggg
aaccagcgggggaccttcttggcacgagagagcgaaacgaccaaaggtgcatactccctg
tctatccgggactgggatgagatgaaaggagataacgtcaaacactacaagatccgtaag
ctggacaacggtggttattacatcaccactcgagcccagtttgagacactacagaagctg
gtgaaacactacacagaacacgccgacggtctgtgctacaggctgactactgtgtgcccc
accgtgaaacctcagactcagggactggctaaggatgcctgggaaatcccgcgagagtcc
cttcgactggaggtcaaactgggccagggctgcttcggagaagtctggatgggcacatgg
aacgggacgactaaggttgctattaagaccctgaagccgggcacaatgtctcccgaggcc
ttcctgcaggaggctcagatcatgaagaaactccgacatgacaaactggtgcctctctat
gccgtggtgtccgaggagcccatctacattgtgacagaattcatgggcaaaggcagttta
ctggacttcctgaaggagggagatggtaaatatctgaagttgccccagctggtggacatg
gccgcacagatcgcagatggcatggccttcatcgagaggatgaactacatccacagggac
ctgagagctgccaacatcctggtggctgataacttggtgtgtaagatcgctgacttcggc
ctggctcgtctcatcgaggacaacgagtacaccgccagacaaggtgctaaattccccatc
aagtggacggctcctgaagcagctctgtacggccgcttcactatcaaatcagacgtctgg
tcgtttggtatactactgactgaactggtgaccaagggcagagtaccatacccaggtatg
gtgaatcgagaggtactcgagcaggtagaacgaggttaccgcatgccctgcccccagggg
tgcccagagtccctccacgagatgatgaggcactgctggaagaaggagccagatgagagg
ccgacgttcgaatacatacaatcctttttggaagactacttcacagccacggagccacag
taccagcctggggacaacctctag

DBGET integrated database retrieval system