KEGG   Larimichthys crocea (large yellow croaker): 104926552Help
Entry
104926552         CDS       T04659                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco03030  DNA replication
lco03410  Base excision repair
lco03420  Nucleotide excision repair
lco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104926552 (lig1)
   03410 Base excision repair
    104926552 (lig1)
   03420 Nucleotide excision repair
    104926552 (lig1)
   03430 Mismatch repair
    104926552 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lco03032]
    104926552 (lig1)
   03400 DNA repair and recombination proteins [BR:lco03400]
    104926552 (lig1)
Enzymes [BR:lco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104926552 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     104926552 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104926552 (lig1)
DNA replication proteins [BR:lco03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104926552 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104926552 (lig1)
DNA repair and recombination proteins [BR:lco03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104926552 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     104926552 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     104926552 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 104926552
NCBI-ProteinID: XP_019120449
LinkDB All DBs
Position
II
AA seq 1012 aa AA seqDB search
MQRSIASFFQPKNKDNNIQKKSADAPVKKPAKSPLKVQNGVQEPDSPIKKVAKRSRQILD
SDDDEAPPAVKEQVATKGQGDKAEKKDDVFKAVPTPLSPPPAPATPVTPATPATPASSAS
PGTPSTPNSISPSGIVKRKTARKTFPKRKLNESMSGSESQKDEAEAKEAQGQQKKRPRVE
SGGSSPGNPGEPMEEGAKEEAVEKAVTEANGPDEEVESEKKEEGEKTREDDEEEEEEQVE
RKGSDEKEKKSEGAMKKNEAKEKTDDEKGPAVAKEEVVEKDTREGEESPKSQTARKQKEA
KEQKDKEPPKKAPISSFFAPRKAVVKTEKPEKSEGEKKTSAERKTSAEDSKDTKGESGQT
DYNPARPNYHPVDHACWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSVLLLSP
DDLLCCVYLCLNQLGPAHLGMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAE
SSRSNQRMMFQPASLTAGGVFRKLKEIAGMSGNSAMNKKIDIIKGLFVACRFSEARYIVR
SLAGKLRIGLAEQSVLSALSQAVCLTPPGQEFPPAVIDAGKGMSTESRRAWIEEKSLILK
QTYCEMPNYDVLIPVLLKEGIDELPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFT
CEYKYDGERAQIHILESGEVRIFSRNQEDNTTKYPDIISRIPKVKKDSVVSCVLDAEAVA
WDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLKE
SFSEVEGEFVFARSIDSDNTETIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLK
LKKDYLEGVGDTVDLCVIGAYLGKGKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDED
LEQHYKFLKEHILPKPRAYYRVEQSAEPDVWLDAVQVWEVKCADLSLSPIYKAGMGMVDP
EKGISLRFPRFLRIRDDKKPEDATTGAQIADLYKKQQQIQNQGEKADLEDYY
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcatccttctttcagcccaagaacaaggacaacaacatccagaag
aaaagtgcagatgcaccagtgaagaagcctgccaaaagccccctcaaggtgcagaacggc
gtccaggaacccgattcgcccatcaagaaggtcgcgaaacgcagccgtcagattctggac
agcgacgacgacgaggcgccgccggccgttaaagaacaagtcgccaccaaggggcaggga
gacaaagcagagaagaaggacgatgtgtttaaggcagttcccaccccgctgtctcctcca
ccagccccggccacccctgtaacgcccgccactccggccaccccggcctcttcggcttca
cctgggacccccagcacccccaactccatctccccgtctgggattgttaaacgcaagacc
gcgaggaagacgttcccgaagaggaagctcaacgagagcatgagcggcagcgagagtcag
aaggatgaggccgaggccaaggaggcgcagggtcagcaaaagaaacgaccccgtgtggag
agcggcggcagcagcccagggaaccccggtgaacccatggaggagggagcaaaggaagaa
gcagttgaaaaggctgtgaccgaggccaacggcccagatgaggaggtggagagcgagaag
aaagaggaaggcgagaagaccagggaggatgatgaggaggaggaggaggagcaggtggag
agaaagggctctgatgagaaagaaaagaaatctgagggggcgatgaagaagaatgaagca
aaggagaagacggatgatgagaaagggcctgctgttgccaaagaggaggtggttgaaaag
gacacgcgcgaaggagaagagagcccaaaaagtcaaacggcgagaaagcagaaagaagca
aaagagcagaaagataaggagccgcccaagaaagcgcccatcagcagtttctttgctccc
aggaaagctgtagtgaagacagagaaaccagagaaaagcgaaggcgagaaaaagacgagt
gcagagaggaaaacttcagcggaggacagcaaagacaccaaaggtgagtcaggacaaaca
gactacaatccagccaggcccaactaccatcctgtggaccatgcctgctggaagcagggc
caaaaagtgccgtacttggctgtggctcgcacctttgagaagattgaagaggactctggc
aggctgagaaacatcgagacgctgtcgaacctgtttcgctccgtgctgctgctctctcca
gatgacctgctgtgctgtgtgtatctatgtttgaaccagctgggtcctgcccacctgggg
atggagcttggcgttggcgagacggtgctgatgaaagctgttgctcaagcaactgggcga
caattggacaaaatcaaggcagaggcgcaggagaaaggcgatctgggcctcgtggcggag
agttcccgtagcaaccagcgcatgatgttccaaccggccagtctgacagcagggggcgtg
ttcaggaaattgaaggaaattgccggcatgagtgggaactcggccatgaataagaaaatc
gacatcatcaaaggcctctttgtggcatgccgcttttccgaggcccgctacatagtcagg
tccctggctgggaagctgaggataggcctggctgagcagagtgtcctatcagcactgagc
caggctgtgtgtctgaccccccctggacaagagttccctccagctgtgatcgacgcgggg
aaagggatgagcacggagagcaggcgggcctggattgaagaaaagagtctcattctcaaa
cagacttactgcgagatgcccaattacgacgtcctcatcccggttctgctgaaagagggc
atagacgagctacccaatcactgcaagctcactccaggcgtgccgctgaggcccatgttg
gctcacccgaccaagggtgtcggcgaggtgatgaagaggttcgatgaggcggcgttcacc
tgcgagtacaaatacgacggagagcgtgcgcagattcacattctggagagcggagaggtt
cgaatattcagccgcaaccaggaagacaacaccaccaaatacccagatatcatctctcgc
attcccaaggtgaagaaggactctgtggtgtcctgcgtcctggacgcggaggccgtggcc
tgggatcgcgagaagaaacagatccagcccttccaggtcctcaccactcgtaagagaaag
gatgtggatgcctcggagatcaaagtccaagtgtgcgtgtacgcctttgacctcctctat
ctcaacggcgagtccctggtgcgacagccgttgtgtcggcgtcgggctctgctgaaagaa
agcttctcagaggtggagggagagtttgtgttcgcccgatccatcgactccgacaacacc
gagaccatcgccgagttcctggagcagtctgtccgagactcctgcgagggcctaatggtg
aagactctggagaaggacgccacctatgaaatcgccaagcgctctcataactggttgaag
ctgaagaaagactacctggagggcgtgggcgacacggtggacctgtgcgtgattggcgcc
tacctgggaaaaggcaagaggacgggcacctatggaggcttcctgctggcctgctacgac
gaggacaacgaggagttccagtccgtctgcaagatcgggacaggcttcaaggatgaagat
ctggagcagcattacaagttcttaaaggagcacattctgccaaagccccgcgcctactac
cgcgtggaacagtcggcggagcccgacgtgtggctggacgccgtgcaggtttgggaggtg
aagtgcgccgacctctcgctgtcacccatctacaaggccggcatgggaatggtggatcca
gaaaagggcatttctctgaggttcccccgcttccttcggatcagagacgacaagaagccc
gaggacgccacgactggtgctcagatcgctgatttgtacaagaagcagcagcagattcag
aaccagggggagaaagccgacctagaggactactactga

DBGET integrated database retrieval system