KEGG   Larimichthys crocea (large yellow croaker): 104926848Help
Entry
104926848         CDS       T04659                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
lco04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104926848
   00500 Starch and sucrose metabolism
    104926848
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104926848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104926848
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104926848
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104926848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104926848
NCBI-ProteinID: XP_027139207
LinkDB All DBs
Position
X
AA seq 969 aa AA seqDB search
MVSYKRLNPEDVQFSTAVLSEEPRPVQEEVPVPEPEEASLLPRRPTCSVTTALLIIGCLL
LLLCGGWLLGTMFWLHRPSNQQPHRPPSPASEQTPGVKTGVNDTAAALRREACSLIPEAW
RFDCYPERGVVVTRELCEARNCCFIPASSASRPSGRNGIPWCFYPLDFPSYSLVSINDTS
LGQKGTFIREVKTYYPADILTLEVEIRHETDTRLHVRITDPSNSRFEVPISVPTATKKAE
SPEYTVELSKQPFGLIVKRSSTGEVLLNTTVAPLFYADQFLQISTSLSSQFIYGLGEHRS
TFLHDIHWNTLTMWARDVPPMEQTNLYGAHPFYLAMEDGGNSHGFFMLNSNAMDVILQPA
PALTWRAIGGILDFYVFLGPDPASVIGQYVDVIGYPAMPIYWALGYHLCRWGYNTSNSTW
DVVKSMRNNRIPQDVQWNDIDYMDQFMDFTYDPTKFDTLPEMVKDLHAHDQRYVIILDPG
ISSTQPEGSYWPYDEGLRRDVFIKDAEGKTLIGKVWPGLTAYPDFSDNATHEWWYDNLQR
FHKKVQFDGLWIDMNEPSNFLDGSTNGCPSNSLENPPYTPGVLGGLLRAKTVCATAQQKQ
SIHYNVHSLYGLMEAKASASAMKRITSKRPFVISRSTFPSQGMYSGHWLGDNRSQWKDLY
TSIAGILTFNLLGIPLVGADICGFGEEPQEELCIRWTQLGAFYPFTRNHNAIDMKPQDPT
AFSPLARTAMKQALLLRYSLFPVLYTLFHHAHVHGHTVARPLMFEFPKDVRTYGIDKQFL
WGKSLLVTPVLDPGVDYVDGYFAEGLWYDYYTGNPVPSKGEEIRLHAPLDKINLHLREGS
VIPTQMPNITLWVSSGQPLHLVSALSDDGSATGDLYWDDGETIDAYENDQYSYIIFNVAQ
NVMTSEVLHSSVEATYITVETASFYGVKQKPSRVLVNSQDAVFTYSTNKMLTVTDLGLNL
SHNFTISWM
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatacaagcggctgaaccctgaagatgttcagttttctactgcagtattgtcc
gaagagcctcgtcctgtccaggaagaagttccagtcccagagccagaggaagcctccttg
cttccacggaggccgacatgctctgtcactacagccctcctgatcattggctgcctgctg
ctgctcctttgtggaggctggctactgggcaccatgttttggttgcacaggccgtccaat
caacagccacataggccgccgtcgccggcctctgaacaaacaccaggagtaaaaacagga
gtgaatgacactgcagctgctttgcgccgtgaggcttgcagtttgatccctgaggcgtgg
aggtttgattgctaccctgaaagaggggtggttgtgactcgagagttgtgtgaggcaagg
aattgttgctttatccctgcatcctctgccagccgtccatcagggagaaatggtatcccc
tggtgtttctaccctctggatttcccttcctactcgcttgtgtcaataaacgacacatct
ctgggacagaaaggtacgttcataagggaggtgaagacctactacccagcagatatcctc
actctagaggtggagatacgccatgagacagacacacggctacatgtcaggatcaccgac
ccttctaattcacgtttcgaggttccgatctctgttcccaccgctaccaagaaggcagaa
agtccagagtacaccgtggagctttcaaagcagccatttggtctcattgtgaagaggagc
tctacaggagaagtgcttctgaacaccacagtggctcctctcttctacgccgatcagttt
ctccagatctccacctccctgtcaagtcagttcatttacggcctaggcgagcaccgctcc
acctttctgcatgacatccactggaacacactcaccatgtgggccagagacgtgcctcct
atggagcagacaaacctatatggagcgcatccattttacctggcaatggaagatggaggg
aactcacacggcttcttcatgctgaacagcaacgcaatggatgtgatcctccagcctgct
ccggccctcacctggcgtgctattggtggaattcttgacttttacgttttccttggtcct
gatcctgcgtcagtgattggacagtatgtggacgtcattggctacccagcgatgcccatc
tactgggctttaggctaccatctctgtcgctggggctacaacactagcaattctacctgg
gatgttgtcaagagcatgaggaataatcgaatacctcaggacgtccagtggaatgacatc
gactacatggaccaattcatggacttcacttatgacccaacaaagtttgacacactgcct
gagatggtcaaggacctgcacgctcacgaccagcgctacgttatcatcctggacccgggt
atcagtagcacacagcctgagggctcatactggccgtacgatgaagggctaagaagagac
gtttttattaaagatgctgaggggaaaacacttattgggaaggtttggcctggcctgaca
gcatatcccgatttctctgacaatgcgacacatgaatggtggtacgacaaccttcagagg
ttccataagaaggtgcaatttgatggattatggattgacatgaatgaaccatcgaatttc
ctggatggttctaccaatggctgtccatcaaacagtcttgaaaatcctccttacacaccc
ggtgtactaggaggtttgctgagagccaaaactgtgtgtgccactgcacagcaaaagcag
tccatacactataatgtgcacagtctctatggacttatggaagccaaggcatctgcaagc
gctatgaaacggatcacgtcaaagagaccttttgtgatctctcgctccaccttcccaagt
caggggatgtactctggtcactggctgggagacaacaggagccagtggaaagacctgtac
acgtctatagcaggtatcttgacctttaaccttctgggcatcccgctggtgggagcagat
atctgtggattcggcgaggagccgcaggaggaactctgtatccgctggacgcagctagga
gctttctatcccttcacacgcaaccacaacgccatcgacatgaagcctcaagacccaaca
gctttcagccctctggctcgtacagccatgaaacaagctctgctgctgcgttattctcta
ttccctgtcctttacactctctttcatcatgcacacgtacacggacacactgttgcaagg
ccgctaatgtttgagttcccaaaagatgtcagaacttatgggattgacaaacagttcctg
tgggggaaaagtttattagtgacaccagtgttggatcctggagttgactatgtggatgga
tatttcgcagagggtctgtggtatgactactacacgggcaaccccgtgcccagtaagggt
gaagaaattcgacttcacgctcctctagataagatcaacctacatttgcgtgagggctct
gttatacctacacagatgcccaacatcaccctgtgggtaagcagcggtcagcctctccat
ctcgtctcggctctctctgatgatggttctgccactggagatctgtactgggacgacgga
gagaccatcgacgcctacgagaacgaccagtactcctacatcatcttcaatgttgctcag
aacgtgatgacatcagaggtgttgcatagcagtgtggaggccacgtacatcaccgtggag
acggcctccttttacggtgtgaagcagaagccgagtagagtgctggtgaactcccaagat
gcagtgttcacctacagcaccaacaagatgttaacagtcacagatctcggcctaaacctc
agccacaacttcaccatcagctggatgtaa

DBGET integrated database retrieval system