KEGG   Larimichthys crocea (large yellow croaker): 104929140Help
Entry
104929140         CDS       T04659                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104929140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 104929140
NCBI-ProteinID: XP_010741890
LinkDB All DBs
Position
Un
AA seq 693 aa AA seqDB search
MAHHKSVFTDVDVRSHENNLAHRTREIDRERLIVRRGQPFSITLQCSGPLPAKHYLELKL
RLGKKDEVVITVQNERGAGDKWWFNQQEAQGEIVLTLHSPADAIIGHYHLAVLLLAHDRH
TVERIDKVTFHMLFNPWCKDDVVYLPDESLLQEYIMNEDGVIYQGAWDYIRSIPWNYGQF
EDFVMDICFEVLDNSNNALKNSVMDMEHRFDPVYVSRIIAAMVNSNGDRGVLAGRWSEPY
ADGVPPYHWTGSVKILRQWSKAGFRAVKYGQCWVFAAVACTVMRCLGIPSRVITNFDSAH
DVDGNLSMDIMLNDRLEPVETKDSKWNFHCWIESWMKRDDLSKGCDGWQVLDPTPQERSE
GEFRCGPCPVTAIKEGKLDLKYDAPFVFAEVNADIVYWVVQRDGQRRKIKEDQKSVGKNI
STKSPYGNYREDVTSHYKYPEGSREEREVYGKAGHRVTGAVEENTEPGQLQLSIKHAKPV
FGTDFDVIVEVKNTGSKEAHAQLTMVATAVTYNSIHRGECQRESINVTVQAHKVHKQVLR
LHYDHYVKCVSEHHVIRVKALLDVLGENEPIMNVVNIPLSKPELLVEVPGMAVLWEKVTA
HVSFTNPLPVPLKGGVFTVEGAGLLPATEIPVIGDVAPGQKVSVKFSFSPMRAGVRKLMV
DFDSDRLKDVKGVGTVVVRKKYTRPFYENLIMY
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccacaagagtgtgtttactgatgtggatgtgagaagtcatgaaaacaacttg
gctcaccgcaccagggaaattgatcgggagcgcctgattgtccgcaggggtcagcccttc
tccataactttgcagtgctctggccctctgcccgccaaacactacctggaactgaaactg
cgccttggtaagaaggatgaggtggtgatcacggttcagaatgagcgtggggctggagac
aagtggtggtttaaccaacaagaagcgcagggtgagattgtgctgactctgcacagtcca
gcggatgccatcattggccactatcacctggcagtgttgctgctggcacatgacagacac
accgtggaacggatcgacaaagtcaccttccacatgctctttaacccctggtgcaaagat
gatgtggtgtacctccccgatgagagtctcctccaggagtacataatgaatgaagatgga
gtgatttaccagggggcctgggactacatccgaagtattccctggaattatggacagttt
gaagacttcgtgatggacatctgttttgaagtcttggacaactccaataatgccctgaaa
aactcagtgatggacatggaacacagatttgaccctgtttatgtcagcaggatcatagcg
gcaatggtcaactctaacggtgacagaggtgtgctggccggtcgatggtctgagccgtac
gctgatggagtcccaccatatcactggactggcagcgtcaagatcctccgacagtggagc
aaggctggcttcagggcggtcaaatatggccagtgctgggtgtttgctgctgtcgcctgc
acagtgatgcgctgcctgggaatcccatcacgtgtcatcaccaatttcgattctgcccat
gatgttgatggaaacctctctatggacattatgctgaatgacagactggaaccagtcgag
acaaaagatagcaaatggaactttcactgttggattgagtcctggatgaagagagatgat
ctctccaaaggatgtgacggctggcaagttttggaccctacccctcaagaacggagtgaa
ggtgagtttcgctgtggtccgtgtccagtgacagccatcaaggagggaaaactggactta
aagtatgatgctccgtttgtatttgctgaggtgaatgctgacatcgtctactgggttgtc
caacgagatggccaacggaggaagatcaaggaggaccagaaatctgtgggaaaaaacatc
agcaccaaaagtccttatggtaactacagagaagatgtcacttcacactacaaatatcct
gaaggctccagggaggagagggaagtgtatgggaaggcaggacatcgggtcacaggggcg
gtcgaggagaacacagaaccgggacaactgcagctctcaatcaagcatgcaaagcctgta
tttgggacagactttgacgtgatagttgaggtgaagaatacaggaagcaaagaggctcat
gctcagctgactatggtggccacggctgttacttacaattccatccaccggggagagtgc
cagagagaatcaatcaacgtcactgttcaagctcacaaagtccacaagcaagttctgcgt
ctgcactacgaccactatgtcaagtgtgtgtctgagcatcatgtgatcagggtgaaggcg
ctcttggacgtattaggggaaaatgaacccatcatgaacgtggtcaacatcccactcagc
aagcctgaactcctcgtagaggtgcctggaatggctgttctatgggaaaaagtaacagcc
catgtctcctttaccaatccactaccagtcccgctgaagggtggcgttttcactgtggag
ggggccggcctactgccagcgactgagatccctgttatcggtgatgtagctccaggccag
aaagtgtctgtcaagttctccttctcaccaatgcgggccggggtgaggaagctcatggtg
gactttgactctgacagactgaaggacgttaagggagttggcactgtggtcgtccgcaag
aaatacacccgtccattttatgaaaatctcataatgtactga

DBGET integrated database retrieval system