KEGG   Larimichthys crocea (large yellow croaker): 104929615Help
Entry
104929615         CDS       T04659                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00480  Glutathione metabolism
lco00980  Metabolism of xenobiotics by cytochrome P450
lco00982  Drug metabolism - cytochrome P450
lco00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104929615 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104929615 (gsto1)
   00982 Drug metabolism - cytochrome P450
    104929615 (gsto1)
   00983 Drug metabolism - other enzymes
    104929615 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lco02000]
    104929615 (gsto1)
Enzymes [BR:lco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104929615 (gsto1)
Transporters [BR:lco02000]
 Other Transporters
  Pores ion channels [TC:1]
   104929615 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin YlbE
Motif
Other DBs
NCBI-GeneID: 104929615
NCBI-ProteinID: XP_010742490
LinkDB All DBs
Position
III
AA seq 239 aa AA seqDB search
MSTEKCFAKGSAAPGPVPKDHIRLYSMRFCPFAQRTRLVLNAKGIKYDTINIHLKDKPEW
FLERNPLGLVPTLETSAGEVIYESPITCEYLDEVYPEKKLLPTSPFGKAQQKMMLEHFSK
ITPYFYKIPMGRKNGEDVSGLEAELKEKFAKLNEDLVNKKTKFFGGDSITMIDYMMWPWF
ERLEIFELQSCLDGTPELKKWTERMLEDPAVKATMHSMDTYKAFYQSYVVGKPDYDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaaaagtgtttcgccaaagggagtgctgcacctggtccagtccccaaagac
cacatcagactttacagcatgagattctgccccttcgcccagaggaccagattagtgctg
aatgccaaggggatcaagtatgacaccatcaacattcatctgaaagacaaacctgaatgg
ttccttgagaggaatcctcttggtcttgtcccaacacttgagacaagtgctggtgaggtg
atctatgagtcgcccatcacctgtgaatacctggatgaagtttacccggagaagaagctg
cttcctacctctccttttggtaaagctcaacagaagatgatgctggagcatttttccaag
ataaccccgtacttctacaagatccccatgggaagaaagaacggggaggacgtctcagga
ctcgaagctgaactgaaagagaagtttgccaaattaaatgaggacctggttaataagaag
accaagttcttcggtggagattccatcacaatgatcgactacatgatgtggccgtggttt
gagaggctggagatctttgagctgcaaagctgccttgacggtacacctgagctgaagaag
tggacagagcgtatgttggaggatccggctgtcaaagctaccatgcacagtatggacacc
tacaaggccttctaccagtcttacgttgtggggaaacccgactatgactatggcctgtag

DBGET integrated database retrieval system