KEGG   Larimichthys crocea (large yellow croaker): 104929647Help
Entry
104929647         CDS       T04659                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00562  Inositol phosphate metabolism
lco01100  Metabolic pathways
lco04068  FoxO signaling pathway
lco04070  Phosphatidylinositol signaling system
lco04115  p53 signaling pathway
lco04140  Autophagy - animal
lco04150  mTOR signaling pathway
lco04218  Cellular senescence
lco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104929647
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104929647
   04070 Phosphatidylinositol signaling system
    104929647
   04150 mTOR signaling pathway
    104929647
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104929647
  09143 Cell growth and death
   04115 p53 signaling pathway
    104929647
   04218 Cellular senescence
    104929647
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104929647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lco01009]
    104929647
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104929647
    3.1.3.48  protein-tyrosine-phosphatase
     104929647
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104929647
Protein phosphatases and associated proteins [BR:lco01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104929647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 104929647
NCBI-ProteinID: XP_010742529
LinkDB All DBs
Position
III
AA seq 445 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSAVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPTHTRREDKHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESGDKMENGAVNNADSQQGVPATGQGQPQSADCRDSCRESGRESDRDRDYLIL
TLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDVSDNEPDHYR
YSDTTDSDPENEPFDEEQHTQITKV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccggaacaaaaggagatatcaagaggatggc
ttcgacctggacttaacatatatctacccaaacatcattgcgatgggctttcctgcagag
agactcgaaggcgtgtacagaaacaatatagacgatgtagtacggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgcgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtaccccttcgaagaccacaaccctcctcagctggagcta
attaagccgttttgtgaagacctggaccagtggctcagcgaggatgacaatcacgtggcg
gccatccactgtaaggccgggaagggccgcactggagtcatgatctgcgcctatctcctc
catcgtggcaaattcctggaggcccaagaagcgcttgatttttacggtgaagtcaggaca
agggacaagaagggagtaacgatcccgagccagcgccgctacgtctactactacagctac
ctactgaagaaccagctagagtacaagccggtggcgctcctcttccacaaaatggtgttc
gagactctccccatgttcagcgggggcacctgcagggacagtgccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccccagtttgtggtg
taccagctgaaagtgaagattcacacgtcgaaccccactcacacgcggcgcgaggacaag
cacatgtttttcgaattcccccagccgctgccggtttgtggagacatcaaggtggagttc
ttccataaacagaacaagatgatgaagaaggacaaaatgttccacttctgggtgaacacc
ttcttcatccctggaccagaggagagcggggacaagatggagaatggggcggtgaacaat
gcagacagccagcagggggtaccggcaacgggccagggccagccgcagagcgccgattgc
agggatagctgcagggaaagcggcagggaaagcgaccgggacagggactacctcatcctg
acgctcactaagaacgacttggacaaggccaacaaagacaaagctaaccgctacttctcg
ccaaacttcaaggtgaagttgtattttacgaaaaccgtggaggagccttcgaattctgag
gcaagcacttcgacatccgtcacgccggacgttagcgacaatgagccagaccattatcga
tattcagataccactgactctgatccagaaaatgaaccttttgatgaagagcagcacacg
caaatcacaaaagtgtga

DBGET integrated database retrieval system