KEGG   Larimichthys crocea (large yellow croaker): 104929882Help
Entry
104929882         CDS       T04659                                 

Gene name
lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    104929882 (lig4)
Enzymes [BR:lco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104929882 (lig4)
DNA repair and recombination proteins [BR:lco03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     104929882 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT_2 BRCT RNA_ligase mRNA_cap_enzyme APG17
Motif
Other DBs
NCBI-GeneID: 104929882
NCBI-ProteinID: XP_010742821
LinkDB All DBs
Position
XIX
AA seq 910 aa AA seqDB search
MEGTSKSDAAGPPSVAAQVPFLHLCTTLEKIQKSKLRPDKNKILGDFVGSWRKFHAALHK
DDPKTTDSFYPAMRLIVPPFERERMAYGIKENMLAKLYINVLGLPNNGPEANKLLNYRAP
TTSQGEAGDFASMAYFVIKKRCTSEGNLTVKEVNDFLDSVAINNASKQKDLVKKSLLHLI
TQSSALEQKWLIRMILKDMKLGISKETVLQVFHPDANDLYNVNTDLNKVCQQLHNPTVSL
SEISIELFSAFKPMLAAVANIRNVEKQMGNSPFYIQTKLDGERIQLHKDGDVYKYYSRNA
FDYTQQFGASPLEGSLTPYIHNVFKSHVVNCILDGEMMAYNPTAETFMQKGSKFDIKRLM
DDSELQTCYCVFDVLLVNGEKLGKKPLEKRYETLQTVFTPVNGRMHLVPKKDGRTMQEVV
NALNDAIDNREEGIMVKDPLSIYKPDKRGEGWLKIKPEYMDGLMDELDLLIVGGYWGKGR
RGGMMSHFLGAVAEAPKPGEKPTVFHTLCRIGSGYTMKELYDLGLKLAKHWKVYRKNDPP
ASILCGTEKPEVYIEPCNSVIIQVKAAEIVGSDMYKTNCTLRFPRIEKIREDKEWHQCMT
LAELDQFRSKASGKLASRHLRIDDNEPQKKKRKMPAKPKKVAGLIDHFKPQDLSGVRKET
DMFEDVEFCILNGTEDHPKAELEKGVARCGGIVVQNPGLDTYCIIAGVENMRVKNLISSD
KHDVVWAAWLLECLDQKDVVPWQPRHMIHMSPSTREHFAKEYDSYGDSYFVDTDELQLRE
VFSRISSVDMSGAVNAAQVEERYGWEDLPTSLFRPFKVYMDRFADIGDPKTAITATCLDI
RALEFRYHGGEVMEKLEEGVSHVIIAEETRLLDLRTLRRCFRKKFKIVRESWVTDSITAG
YLMNDTDYLV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggagggaacttccaaaagtgatgctgcaggtccgccctctgttgctgctcaggttcct
ttccttcacctgtgtaccaccttagagaaaatccagaaatccaaactccgtcctgataaa
aacaaaatcctcggggatttcgttgggtcatggaggaagtttcatgctgctctccacaaa
gatgaccccaaaacaacagactctttctacccagctatgcgtctcatagtccccccgttt
gaacgagagcgcatggcgtatggcatcaaggagaatatgttggctaaactctatatcaac
gtattaggtctcccaaataatggcccagaagccaataagctgttgaactaccgtgcacca
actacttcccaaggagaagctggagactttgccagcatggcgtactttgtaataaagaaa
cggtgcaccagtgagggaaacctcactgtcaaagaagtcaacgactttctcgactctgtg
gccatcaacaacgccagcaagcagaaagatcttgtaaaaaagagtctgctgcacctcatc
acccagagctcagcgcttgagcaaaaatggctcattaggatgattctgaaggacatgaag
ctcggtatcagcaaagaaacggtcctacaagtcttccacccggatgctaatgacctctac
aatgtcaacacagacttaaacaaggtgtgccagcagctccacaaccccactgtgtcttta
agtgaaatttctatcgagctcttctctgcctttaagcccatgctggcagctgtggcgaac
atccgcaatgtggagaaacagatggggaacagccccttttacattcagaccaagctggat
ggggagcggatacaactgcacaaagatggcgatgtgtacaagtactatagccgaaatgcc
tttgactacacgcagcagtttggagcatccccactggagggctcgctcacaccttacatc
cacaacgtctttaaaagccacgttgtaaactgtatccttgatggtgagatgatggcgtac
aacccgaccgctgagaccttcatgcagaaagggagcaagttcgacatcaagagactcatg
gacgactcagagttacagacgtgctactgcgtgtttgacgtgttgttagtcaatggtgag
aagcttggcaagaaaccgctggagaaacgctatgagacccttcagacggttttcaccccg
gtcaatggaaggatgcacctggtaccaaagaaagatggcagaaccatgcaggaggtggtg
aatgccctcaatgatgccattgacaacagagaagaggggatcatggtgaaggatcctttg
tccatctacaaacctgacaaacgaggggagggatggctaaaaataaagccagaatatatg
gatggcttgatggatgagcttgacctgctgattgtcggtggctactgggggaaaggaaga
cggggtggtatgatgtcccatttcttaggtgctgttgcagaagctccaaagcctggtgag
aaacctacagttttccacacactatgccgcatcggctctggctacaccatgaaggagttg
tatgaccttggtttaaagctagccaaacactggaaagtctatcgtaaaaatgacccacca
gcatccatcttgtgtggaacagagaaaccagaagtttacatcgaaccctgcaactctgtc
atcatccaggtcaaggcggctgaaatagtcggaagtgatatgtataaaaccaactgcact
cttcgcttccccaggattgagaagatccgtgaagacaaggagtggcaccagtgcatgact
ctggcagagctggatcagtttcgcagcaaagcatctgggaaacttgcctcgcggcacctt
cgcattgacgataacgaaccacaaaagaagaagcgcaagatgcctgccaaacccaagaag
gtggccgggctaatcgaccactttaaaccccaggacctttctggggtaagaaaggagact
gatatgtttgaggacgtggagttctgtatcctgaatggcacagaggatcaccccaaggct
gagctggaaaagggtgtggccaggtgtggaggtatcgtagttcaaaacccaggactggac
acttactgcattattgctggtgtggagaacatgcgagtgaaaaacctgatttcgtccgac
aagcacgacgtggtgtgggccgcctggctgctggagtgcctggaccagaaggatgtggtc
ccatggcaaccgcgacacatgatccacatgtcgccctccaccagggagcactttgccaaa
gagtacgacagctatggcgacagctactttgtggacacggacgagctgcagctgcgggag
gtgttcagccggataagcagcgtggacatgtctggagcggtgaacgctgcacaggtggag
gagcgttacgggtgggaggaccttcccaccagcttgttcagacccttcaaggtttacatg
gaccgctttgccgacatcggcgaccctaaaacagccataactgccacctgtttggacatc
agggcgctggaatttcgctaccatggtggggaggtgatggagaagttagaggaaggagtc
tctcatgtgatcattgcagaggaaacaagacttctggatttaaggactctgaggcgctgc
tttaggaagaagtttaagattgtccgagaatcttgggtgactgattcaatcacagcaggg
tatctgatgaatgacaccgactatttagtctga

DBGET integrated database retrieval system