KEGG   Larimichthys crocea (large yellow croaker): 104930266Help
Entry
104930266         CDS       T04659                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00240  Pyrimidine metabolism
lco00983  Drug metabolism - other enzymes
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    104930266 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104930266 (tk1)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104930266 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 Ribosomal_L40e ATPase_2
Motif
Other DBs
NCBI-GeneID: 104930266
NCBI-ProteinID: XP_010743314
LinkDB All DBs
Position
Un
AA seq 231 aa AA seqDB search
MDCVDFPRVLPNSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYNCLVIKYAKDTR
YSEKGMATHDKNTMEAVPANCLTDVRSLALQACVIGIDEGQFFPDTVEFCEEMANLGKTV
IVAALDGTFQRKPFGNILNLVPLAESVVKLHAVCMQCYKEAAYTKRIGAEKEVEVIGGAD
KYQAVCRKCYGDLMVNKENSAPFRNETPQQTLVGKHMDSGIPRKLFSSLQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggactgcgtggactttcccagagttcttcccaattcaccgaggaaagcccgggggcag
attcaggtcatctttggaccgatgttttcaggcaagagcactgaactgatgcggagagtg
cgccgtttccaaatagcccagtacaactgcttggtgatcaaatacgccaaggacacacgt
tattctgagaaaggcatggccacacatgacaaaaacacgatggaggctgttccagccaac
tgcctgacagatgtgcggtctttggcgttgcaagcctgtgtcattggaattgacgaagga
cagttttttccagacacagtagagttttgtgaggagatggccaatttaggcaagacggtc
attgtagctgccttggatggaaccttccagagaaagccatttggaaacatcctgaacctc
gtccctctagcggagagcgtggtgaagctccacgccgtctgcatgcagtgttacaaagaa
gctgcctacacaaagaggataggagcagagaaggaggtggaagttatcggtggagcggac
aagtatcaggcggtgtgtagaaagtgttatggagatctgatggtgaacaaagagaacagt
gctcctttcaggaatgaaacgccacaacagaccctcgtaggaaaacacatggactctggg
attcccaggaagcttttctcctctctccaactctga

DBGET integrated database retrieval system