KEGG   Larimichthys crocea (large yellow croaker): 104930340Help
Entry
104930340         CDS       T04659                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
lco04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104930340 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104930340 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lco01003]
    104930340 (gys1)
Enzymes [BR:lco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104930340 (gys1)
Glycosyltransferases [BR:lco01003]
 Polysaccharide
  Storage polysaccharide
   104930340 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 104930340
NCBI-ProteinID: XP_010743405
UniProt: A0A0F8BPF6
LinkDB All DBs
Position
Un
AA seq 711 aa AA seqDB search
MPLARSLSATSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYVESNVRTQVELIEPTNPTLKRTIDKMNSSGCKVYFGRWLIEGSPYVILIDVA
FTAWSLDSWKSELWELCDIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEEPPHIVAHFH
EWLAGLGLVLCRHRQLPVATIFTTHATLLGRYLCAGNVDFYNKLADFNVDKEAGDRQIYH
RYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAVHEFQNLHAQS
KNRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQCQPPICTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSELLDWRY
LGKYYTSARHMALAKAFPDTYMYELHEPTSNSGFRYPRPASVPPSPALSRHSSPHHSEGE
DNDDDERYDEDLEAEKDRVNIRQPYALPFKNKSSAAHGVNGNSNVVTSEKN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctgtccgccacgtccttgtcaggactggaagagtgggacgag
gagtttgatttggaggatgctgttctttttgaaatagcatgggaggtcgctaacaaagtt
ggaggcatctacaccgtcatccagaccaaagcccgactgacctcagaggaatggggggag
aactatttcctcgtgggtccctacgtagagagcaacgtgcgcactcaggtggagctgatc
gagcccaccaaccccacgctgaagagaaccattgacaaaatgaactccagtggttgtaag
gtctactttgggcggtggcttatcgagggcagtccatacgttattctgattgacgttgcg
ttcactgcctggtctctggactcctggaagagcgagttgtgggagctttgtgacatcggc
gtaccatggttcgaccgtgaggccaacgatgctgtgctgtttggcttcctgacggcctgg
ctcctgggagagtacgcagcccagtgtgaggagcctccgcacatcgtagcccatttccac
gagtggttggccggcctgggtctggtattgtgtagacacagacagctgccggtcgcaacc
atcttcacaactcacgccactctgctgggacgatacctgtgtgctggaaatgtggacttc
tataacaagcttgcggatttcaatgtggataaggaagcaggcgacagacagatctaccac
cgctactgtttggagcgggcggccgctcactgtgcccatgtcttcaccactgtgtcacag
atcacagccattgaggcagagcacctgcttaagaggaaaccagacattgtcactcctaac
gggctcaacgtgaagaagttctcagccgtgcacgagtttcaaaacctccatgctcagagc
aagaatcggattcaggagttcgtcaggggacacttctacgggcaccttgacttcaacctg
gacaagtgtttgtttctcttcatcgctggaaggtacgagttctccaacaaaggagctgac
atctttttggaagctttagccagactcaactatctactgagagtcaatcacagtgacgtg
accgtcatcgctttcttcatcatgccagctcgtacaaacaacttcaacgtggagaccttg
aagggccaagcagtcagaaaacagctgtgggatactgctcagactgtgaaggaacgtttc
ggaaagaaactttatgagtcacttctagttgggcagttgccagatgtgtcgaagatgctg
gacaaagaggatttcaccataatgaagcgggccatctttgcgactcagagacagtgccag
cctccaatctgcacccataacatgctggaggacagcagcgaccccatccttaactgtgtc
cgccgtatcggccttttcaacagctctgctgaccgtgtcaagattatcttccatccagag
ttcctttcatccacctctcctctacttccgatggattatgaagagtttgtaagaggatgc
caccttggcgtctttccctcttactatgagccttggggctacacaccagctgagtgcacg
gtcatgggaattccatcaatctcaaccaacctgtcaggctttggctgtttcatggaggaa
cacatagcagacccttcagcatatggtatttacatcctggaccgacgatttcggggtgtg
gacgagtcgtgtaaccagctcacttccttcctgtttcagttctgcaagcagagccggcgc
cagcggatcatccagaggaaccggactgagcgtctgagcgaactcctggactggagatac
ctcggcaagtactatacctctgcccgtcatatggccctggctaaagccttccctgacacc
tacatgtatgaacttcatgagcccacctcaaactcaggtttccgttacccgcgaccagcc
tctgtgccaccatctccagctctgtcccgccactcctccccccaccacagcgagggagag
gacaacgatgatgacgaacgctacgatgaggatctggaggcagaaaaggaccgggtgaac
atccgccagccctacgccctgccgttcaaaaacaagtcttctgctgcacatggggtcaat
ggaaatagcaatgttgtcacgagcgagaaaaactga

DBGET integrated database retrieval system