KEGG   Larimichthys crocea (large yellow croaker): 104930576
Entry
104930576         CDS       T04659                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04141  Protein processing in endoplasmic reticulum
lco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104930576 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104930576 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104930576 (atf6b)
Transcription factors [BR:lco03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104930576 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU HAUS6_N DUF3140
Other DBs
NCBI-GeneID: 104930576
NCBI-ProteinID: XP_027142426
LinkDB
Position
XIII
AA seq 699 aa
MSTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGDFSRGLKFEPSFDNDLVLTL
DPDNPTSPWRHLDDNLLTGEAPVIKSEMTITQPLPVEMLFQVKAEPPSPASSLGSDCSVS
SPDPQITVKGENPPTPPYMYGDVLSPPLGSMEITVATTAVPPPQTQIPAVIGGIQTQAAV
LPSSATLKASTILSTKPPIQPRPVCVTTLPVPQTPAPAKTLILQGLPSMDQTRPVVLSQS
VCLGSAPAIVKMEPVSPSIPQHCSSPTAPPTSKPIVPATTTLPGNGSNDIDMKVLKRQQR
MIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRERLAGKEGSDSASNKR
AVCVMAVLLFMTFSFGPVSITDRKLSGLQEGVVSYTGRHLLEIGQKKQQQYRQQQEETAT
HPSSRVEDKTETEEEGGDDAPESYQFRNLSDVFSDMKDLVLQDIDRYFASSDCRQFNRSE
SLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKIAQKAQLRKTNFSRYLPIQTHRSIESQ
LQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMSVN
ESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPPPPSSHHNSHHHGNHTSL
RGRHHPHPAPSSSSPSSQRQPLPARRRTAKYLISQSEGV
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgagtacggacttactctctgacctggacagccgattcttcgcagacaacctcctgaca
agcgaagactgggatgcctgcctgtaccagtgtgagagcatggaggagggcgaggacgga
gacttcagccgggggctgaaattcgaaccatcgtttgacaatgacctcgtgctcaccctc
gatcctgacaaccccacatcgccatggcgacacctggacgacaacctcctcacaggagaa
gctccagtgatcaaaagtgaaatgaccatcactcagccgctgccggtggaaatgttgttt
caggtgaaggctgagcctccctctcctgcatcctcactcggctctgactgctcggtctca
tcaccggaccctcagatcacagttaaaggtgaaaaccctccgactcctccctacatgtac
ggcgacgtgctgtctcctccgctgggatccatggagatcaccgtggcgacgaccgccgtg
cctccaccacagacgcagatccccgcggtcatcggcggaatacagactcaggctgcagtt
ctgccgagttcggccacgttgaaggccagcaccatcctgagcaccaagccccccatccag
cccagaccggtgtgtgtcaccaccctccccgtcccgcagacaccggcaccggccaagacc
ctcatactgcagggcctcccctccatggaccagaccagacccgtcgtcttgtctcagtcc
gtctgcctcggttctgctccggccatcgtcaaaatggagcccgtctctccgagcatcccg
cagcactgctccagcccgaccgctccgcccaccagcaaacccatcgtcccggcgacgacg
acgttacctggcaacggctccaacgacatcgacatgaaggtgctgaagcggcagcagagg
atgataaagaaccgggagtcggcctgccagtcgaggaagaagaagaaggagtacctgcag
aacctggaggcccagctcagggaggcccagcaggagaacgaacgtctccggagagagaac
caggcgctgagggagaggctggccgggaaagagggcagcgactcggcgagcaacaagcga
gccgtgtgcgtcatggccgtcctgctgttcatgaccttcagcttcggccccgtcagcatc
acggacaggaagttgtcgggcctacaggaaggcgtggtgtcgtacacgggacggcatctg
ctggagatcggacaaaaaaaacagcaacagtatcgacagcagcaggaggagacagccact
catccgtcaagcagggtggaggacaagacggagacagaggaggaaggaggagacgacgct
ccggagtcgtatcagttcaggaacttgagtgacgtcttcagtgacatgaaggatctggtt
ctgcaggacatcgatcggtacttcgcctcttcagactgcagacagttcaaccgctccgag
tctctcaggctggccgacgagctccgaggctgggttcatcgacatcagatcgacaggaag
aaatctggagggaaaccaaagatcgccaagaaggcgaagatcgcccagaaagctcagctg
aggaagacgaacttctccagatatctgcccatccagacgcaccgctccatagaaagtcag
ctgcaggtgcttcccggtcctgaggtcacgtacagcgacttcctggacgccatcgaccgc
agagaggacaccttctacgtggtctctttcagacgggatcacctgctgttaccggccatc
agccacaataaaaccagcagacccaaaatgtctctggtgatgccggccatgtccgtgaac
gagagcctctataactcctctcagggttacgagatgatgatgcaggtcgactgtgaggtc
atggacacgcgcatcgtccccatcaagtcgtccgccgtcccgccgtctctccgcgacccg
cccccgcctcccccctcctcccaccataactcccatcaccacggcaaccacacctcgctg
cggggacgccaccatcctcaccccgccccctcgtcctcctcgccgtcatcgcagaggcaa
cctttacctgcgcggcggcggacagcgaaatatttaatcagccaatcagaaggagtctga

DBGET integrated database retrieval system