KEGG   Larimichthys crocea (large yellow croaker): 104930949
Entry
104930949         CDS       T04659                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lco  Larimichthys crocea (large yellow croaker)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 104930949
NCBI-ProteinID: XP_010744152
UniProt: A0A6G0J4M2
LinkDB
Position
VI
AA seq 365 aa
MSWGEFIELRDLRSDREQIELTGSRSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
STQDPQLPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWDRGPLTDHTCVVEHTVETDTNVDEKVEWGKQELTTADIQQKVKEYNAQINSNLF
MNMNKDGSYTGFVKVQFKLARPVSVTPPKKGGHDAGGKKASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYIRKLSDDERPLRLRLCSGPN
EKVLSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggggagttcatcgagctccgtgacctgaggtcggacagagagcagatagag
ctgaccggatcacgctcgccctgctcgcctccacgcctggaaagaacaaacgccctgaga
atcagcccggggaaggtgccagacctgttgagccgggtgggcatcatccgagtcctgagc
agcacccaggacccccagctccctgaggagaagggagagggacacaacttccagccttgc
agccacgctcagcccacgtggtgtgacttgtgtggagacttcatctggggactttacaag
cagagcctgcggtgtgtcaattgtagattcacatgccattaccgctgtcgtgcactgatc
cggctggactgcagctgggaccgaggccctctgactgaccacacatgtgttgtggagcac
acggtagaaacagacacaaatgtggatgaaaaagtcgaatggggaaagcaggagctgaca
actgcagatattcagcagaaggtgaaggaatacaacgctcaaatcaacagcaatctgttc
atgaacatgaacaaggatggttcatacactggcttcgtaaaagtgcagttcaagttggcc
cgccccgtgtctgttacacctccaaagaaaggaggtcacgacgctggagggaagaaggcg
agtggagtgaaacgtcgtacctctttctacctgccaaaggacgcatccaagcacctgcac
ataagctcacgcacttctgctcgtgaagtcatcgaggctttgctgaaaaagttcaccgtg
gtggacaatcctggcaagtttgctctgtttgagcgcagcgagcgccatgaccaagtttac
attcgcaagctgtctgacgatgaacgtcctctccgcctgcgtctgtgctctgggcccaat
gagaaggtcctcagctttgttctcaaagagaatgaaactggagaagtcaattggcatgcc
ttctccatgcctgagctgaagaacttcctgcgcattctgcagcgtgaagaggaggaacac
gtgaagcagatagtgcagcgatacgctctcgcccgcactaaaatgcaggaggctttggct
ggctcgacccccggctga

DBGET integrated database retrieval system