KEGG   Larimichthys crocea (large yellow croaker): 104931025Help
Entry
104931025         CDS       T04659                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00250  Alanine, aspartate and glutamate metabolism
lco00410  beta-Alanine metabolism
lco00430  Taurine and hypotaurine metabolism
lco00650  Butanoate metabolism
lco01100  Metabolic pathways
Module
lco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104931025 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104931025 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104931025 (gad1)
   00430 Taurine and hypotaurine metabolism
    104931025 (gad1)
Enzymes [BR:lco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104931025 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 104931025
NCBI-ProteinID: XP_019110730
LinkDB All DBs
Position
XVIII
AA seq 592 aa AA seqDB search
MAASAPSSSGGEPDPNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNSLEERSR
IVSSFKERAAKNLQLSCDNMGGETRFSRTETDFSNLFARDLLPAKNGEEQTMQFLLEVVE
ILTNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRT
GHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPDG
EGDGIFSPGGAISNMYSVMIARYKFFPEVKTKGMAAAPRLILFTSEHSHYSIKKASAALG
FGTENLILLNTDERGRVIPADLEAKVIEAKKKGYVPMFVNATAGTTVYGAFDPINEIADI
CEKYNMWLHVDGAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVPLQCSAILVRERG
LLQGCNSMCAGYLFQPDKQYDITYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDK
CLDLSAYLYNKIKNREGYEMVFNGEPQHTNVCFWYFPPSLRGLPDGEERRERLHKVAPKI
KALMMESGTTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLIEEIERLGNDL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgcaccctcctcctctggcggcgaaccggatcccaactcgacaaattta
cgaccaccgggctcaagctatgatgcttggtgtggagtcgctcatggatgcactagaaaa
ctggggatgaagatatgtggatttttgcagaagaacaacagtctggaggagaggagcagg
attgtgagttccttcaaggagcgcgcagccaagaacctgcagctgtcctgcgataacatg
ggcggagagacgcgtttcagccgcacggagaccgacttctccaacctgttcgccagagat
ctgctgcctgctaaaaatggagaggagcagaccatgcagttcttgctggaggttgtggag
atcctcacaaactacgtcaggaagacctttgacagatccaccaaggttttggacttccac
caccctcaccagctcctggagggcatggagggcttcaacctggagctctctgaccagccc
gagtctctggagcagatcctggtggactgcagggacaccctgaaatatggagtgagaaca
gggcaccccaggttctttaaccagctgtccactggattagacatcgttggcttggcagga
gaatggcttacctctacagccaacactaacatgttcacctatgagatcgcacccgtcttt
gtgctcatggagcagctgacgctgaaaaagatgagggagatcgtcggctggcctgatgga
gagggtgatggaatattttctccaggaggagccatctccaacatgtacagtgtgatgatc
gccagatacaagttcttccccgaagtcaagaccaaaggcatggcagctgctcccagactg
atcctcttcacttcagagcatagccactactccatcaagaaagccagtgcagctctgggc
ttcgggacagagaacctgatccttttgaacacagatgagagaggaagagtcatccctgct
gatttggaagccaaagtaatagaggccaaaaaaaaggggtatgttccgatgtttgtgaat
gccactgctggtaccaccgtctacggagcctttgatcccatcaatgaaattgcagacatc
tgtgaaaagtacaacatgtggcttcatgtggatggcgcatggggaggaggtttgctaatg
tccaggaaacacaggcacaagctgagcggagtcgagagggccaactcagtcacctggaac
cctcataaaatgatgggagtgccgctgcagtgctctgccattctggtcagagagagggga
ttattacaaggctgcaactccatgtgtgctggttacctcttccagccagataaacagtat
gacattacatacgacaccggtgacaaggccattcagtgtggacgccatgtcgatatcttc
aagttctggcttatgtggaaggcgaagggaacagtaggatttgaacagcacatcgacaag
tgcctggatctatcagcatacctctacaataaaataaaaaacagagagggctacgagatg
gtgtttaacggagagccgcagcacactaatgtgtgtttctggtactttccaccgagcctg
cgcggcttgcctgatggcgaagagaggcgggagaggttgcacaaggtggccccaaagatc
aaggcactgatgatggagtccgggactacgatggtgggctaccagccacaaggagacaag
gtcaacttcttccgcatggtcatctccaaccccgctgctaccaggtcagacatcgacttc
ctgatcgaggagatcgagcgactggggaacgacttgtaa

DBGET integrated database retrieval system