KEGG   Larimichthys crocea (large yellow croaker): 104931258Help
Entry
104931258         CDS       T04659                                 

Gene name
amylase
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104931258 (amylase)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     104931258 (amylase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 104931258
NCBI-ProteinID: XP_010744521
LinkDB All DBs
Position
Un
AA seq 512 aa AA seqDB search
MKWFILVALFGLGLAQHNPHTRHGRTSIVHLFEWRWADIAAECERFLAPNGFGGVQISPP
NEHIVLNNPWRPWWQRYQPISYNLCSRSGSEDELRDMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSSCGSWFSAGRKDFPSVPYSHLDFNDNKCKTGSGNIENYGDANQVRDCRLVSL
LDLALEKEYVRGKVVDFMNKLIDMGVAGFRVDACKHMWPGDLSAVYGRLHNLNTKWFSGG
SRPFIFQEVIDLGGEPISSREYFHLGRVTEFKYGAKLGTVFRKWNNEKLHYTKSWGEGWG
FMPNGNALVFVDNHDNQRGHGAGGASIVTFWDSRLHKMAVAYMLAHPYGVTRVMSSFRWN
RHIVNGKDQNDWMGPPSHGDGSTKSVPINPDQTCGDGWVCEHRWRQIKNMVIFRNVVNGQ
PHSNWWDNQSNQVAFGRGNRGFIVFNNDDWNLDVTLNTGMPGGTYCDVISGQKEGSRCTG
KQIHVGSDGRAHFKISNRDEDPFVAIHAESKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggtttattctggtggctctgttcgggctcggcctcgcccagcacaacccccac
accaggcatggcaggaccagcatcgtccacctgtttgagtggcgttgggcggacattgcc
gcagagtgtgagcgtttcttggctccaaatggcttcggtggagttcagatctcccctcca
aatgagcacattgtactgaacaatccctggaggccttggtggcagagataccaaccaatc
agctacaacctttgctccagatctggcagcgaggacgaactgagagacatgatcaccaga
tgcaacaacgttggggtcaacatctacgtggatgctgtcatcaaccacatgtgcggagcc
ggcggtggagaaggaacccattcttcatgtggaagctggttcagtgctggcaggaaggac
ttcccctctgtcccctacagccacttggatttcaatgacaacaaatgcaagactggcagt
ggcaatattgagaactatggtgatgccaatcaggtacgtgactgtcgcctggtcagtctg
ttggacctcgccctggagaaagagtatgtcaggggtaaggtggtcgacttcatgaacaag
ctgattgacatgggtgtggctggattcagagtggatgcttgcaagcacatgtggcccggt
gacctttctgctgtctatggtcgtctgcacaacctcaacaccaagtggttctctggtggc
tccagacctttcatctttcaagaggttattgatctgggaggtgagcccatttcctctaga
gagtatttccatctgggaagggtgactgagttcaaatatggtgccaaactgggaactgtc
ttcagaaaatggaacaacgagaagctgcattacaccaagagctggggagagggatggggt
ttcatgcccaatggaaatgctttagtctttgtggataaccacgacaaccagagaggccac
ggcgctggtggtgcgtccatcgttaccttctgggactccaggctccacaagatggctgtt
gcctacatgctggcccacccttacggagtaaccagggtgatgtctagcttccgctggaac
cgccatattgtcaatggaaaggatcagaatgactggatgggccctcccagccacggtgac
ggatccaccaagtctgttcccatcaacccagaccagacttgtggagacggatgggtgtgt
gagcacagatggcgtcagatcaagaacatggttattttccgtaacgtggtcaatggacag
cctcattccaattggtgggacaatcagagcaaccaggttgcctttggacgtggcaatcgc
ggtttcattgtcttcaacaacgatgactggaacctggatgtgaccctgaacactggcatg
cccggtggcacctactgtgacgtcatttctggccagaaggaaggaagcaggtgcactggg
aagcagatccacgttggcagtgatggacgtgcccacttcaagattagcaacagagatgag
gaccccttcgttgctattcatgccgagtccaagctgtaa

DBGET integrated database retrieval system