KEGG   Larimichthys crocea (large yellow croaker): 104931349Help
Entry
104931349         CDS       T04659                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: SWI/SNF complex subunit SMARCC2
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lco03021]
    104931349
   03036 Chromosome and associated proteins [BR:lco03036]
    104931349
Transcription machinery [BR:lco03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     104931349
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    104931349
   PBAF complex
    104931349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_1 SWIRM-assoc_3 Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 104931349
NCBI-ProteinID: XP_019127643
LinkDB All DBs
Position
VI
AA seq 1130 aa AA seqDB search
MLCTAAPPAVTVPVITAPVCGAVQPGCSTGARPLGGSRRRRQTGSLQAKMAVRKKDGGPN
VKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNP
PLTKLPMKCFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSL
VQNNCLTRPVIYLSPDIEPKLLGKLKDIIKRHQGSVTEDKASSSHVVVPIPTSLEEEEWV
RPVMKRDKQVLLHWGYFPDSYDTWIPASEVEAAVEDPPSPEKPRKVHAKWILDLDQYNEW
MNEEDYEVGEGCPKRKRISAKTLTDEVTTPDERRDKKPGSAKKRKRSPSPSPTPPPQESK
KKNTKKGPTTPYTKSKRGQREEEQEDLSKDMDEASPVPASEEGNPAKTNNTKKDSDSTPV
KGGTDMDEQEDESMETTGKEEEEGSPSVKGEPVKGSDLHEDNVTEQTHHIIIPSYAAWFD
YNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDV
CAIMRVHAFLEQWGLINYQVDSESRPTPMGPPPTSHFHVLADTPSSLVPLQPKTSQPHTH
THTHRQKDTCKKILGRFKHLSVTVCSQTPATQQMMSFPDKVKDKPADLQNFGLRTDMYSK
KTSSVKSKSTASSMRDWTEQETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPI
EDPYLEDNSSSLGPLAYQPIPFSQAGNPVMSTVAFLASVVDPRVASAAAKSALEEFSRMK
EEVPAALVEAHVRRVEEAARVSGRQDPLYGLEGSGIAGTGLEEGDRPDENSDESKNDGQS
NEEKREAKENKDGAIEEEEKQAENGKKEEERGREEGEREADKTESEMGDGEKEKDGKEGT
EEGQREAESEGERKAKVERDVGEGNLATAAASALAAAAVKAKHLAAVEERKIKSLVALLV
ETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQSFHMEQLKYAEMRARQQHFQ
QIQHQQHSQAGGPHSNQAVAGPPPQGPTATQPAPSTPAPQPAPSPAPPATSAPAPESQPP
QGQAHTSPPCPPGQTPAAHSSSSTTPVLHEPTAPLPGETLHPSAPVPPPQ
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcacagcggcgccacctgctgtcacggtgccggtcatcacagccccggtgtgc
ggggccgtgcagccgggctgcagcaccggagcgaggccgctgggcggcagccgacgtcga
cgacagactggcagtctgcaggcaaagatggcggtacggaagaaagacggcggcccgaat
gtgaaatatttcgaagcgtctgacaccgtttctcagtttgataatgtccgcgtctggctg
gggaagaattacaaaaagtacatccaggctgagccccccaccaacaagtctctgtccagc
ctggtggtccagctgctccagttccaggaggaggtgttcggccgacatgtcagcaacccg
ccactcaccaagctgccaatgaagtgttttctggacttcaagtcaggaggggctctctgc
cacatcctggctgccgcctacaagttcaagagcgaccaaggatggcgcaggtttgacttc
cagaatccgtcgaggatggaccgaaatgtggagatgttcatgacgatcgagaagtcctta
gtgcagaacaactgcctgacaagacccgtcatctacctgagccctgatatcgagccgaag
ctgctcgggaaactgaaagacatcatcaaaagacatcagggctcagtaactgaagacaag
gcctccagctcccatgttgtcgtccccattcccacgagcctggaggaggaggagtgggtg
cgtcccgtgatgaagagagataagcaagtgctgctccactggggatattttcccgacagt
tatgatacctggattccagccagcgaggtcgaagctgctgtggaggatcctcccagcccg
gaaaagcccaggaaggtccacgcaaagtggattttagacctggatcagtataacgagtgg
atgaacgaggaggactatgaagtgggcgagggctgtcctaagaggaagcggatctcagcc
aagaccctgacagacgaggtgaccacacctgacgagcggagagacaagaagcccggcagc
gcgaagaagaggaagcgctcgccgtcaccttctcccacccctccgcctcaggagagcaag
aagaaaaacaccaaaaaagggccaacgactccgtacaccaagtctaaacggggccagagg
gaggaggaacaggaggatcttagtaaggacatggatgaagcatcgcctgttccggcatct
gaagagggaaaccctgcaaagacaaacaacaccaagaaagactctgattcaactccagtc
aagggaggaacagatatggacgagcaagaggatgagtccatggaaacaacgggcaaggag
gaggaggaaggctctccgagtgtgaagggtgaaccggtgaaagggtcggaccttcacgag
gacaacgtgaccgagcaaactcatcacattattataccgagctacgccgcctggttcgac
tacaacagtgttcatgccattgagcgcagagccctgccagagttcttcaatggaaagaat
aaatccaaaactcctgagatttacctggcttacaggaacttcatgatcgacacctaccgg
ctgaaccctcaagagtacctgacctccaccgcctgccgcaggaacctggcaggagacgtg
tgtgcaatcatgagagtccacgccttcctggagcagtggggtctgatcaactaccaggtg
gactctgagagccggcccacacccatgggtcccccacccacctctcatttccatgtcttg
gcagacactccatccagcctggtgcccctccagcccaagacatcccagccacatacacac
acacacacacacagacaaaaagacacatgcaaaaaaattctgggtcgttttaaacatttg
tctgtcactgtgtgctcacagacccctgctacccagcagatgatgtccttcccagataaa
gtgaaggataaaccagcagatctgcaaaactttggcctgcggactgacatgtacagcaag
aagaccagctccgtaaagagcaagagtacagcgagctccatgagggactggacagagcaa
gaaacactactactactcgagggtttggagatgtacaaggacgactggaacaaggtttca
gaacacgtgggcagccgtacgcaagacgagtgcatcctgcacttcctgcggctgcccatc
gaagacccttacttagaggacaactcctcatccctgggaccgctggcctaccagccgata
cctttcagccaagcgggaaacccagtcatgagcacggtggccttcctcgcctctgtcgtc
gacccgcgcgtggcttcggctgcagccaaatctgctctggaggagttttctcgtatgaag
gaggaagtccctgcagcgcttgtcgaggcccatgtgcggcgggtggaggaggcggcgagg
gtcagtggccgacaggatccgctgtatggactggagggaagtggcatcgcaggcactggc
ctggaggaaggagacagacctgatgaaaacagcgatgaaagcaaaaacgacggccagtcg
aacgaagagaagagagaggcgaaggagaacaaagatggagcgattgaggaagaggagaag
caggcggagaacggcaagaaggaggaagaaagaggacgagaagaaggagagagggaggcg
gacaaaacagagtccgagatgggcgatggggagaaggagaaggatggaaaagagggcaca
gaggagggacagagagaagcagagagtgaaggagaaaggaaagctaaggtggagcgtgac
gtgggagaggggaacctggccaccgctgctgcgtctgcgctcgccgctgctgccgtcaag
gccaagcacctcgccgcagtggaagagaggaagatcaaatctctcgtggctctgctggtg
gagacccagatgaagaagctggagattaaactgcgacactttgaagaactggaaactatc
atggacagagagagggaggctttggagtatcagcgtcagcagctgctggctgaccgtcag
tccttccacatggagcagttgaaatacgctgagatgagagcccgccagcagcacttccag
cagatccagcaccagcagcacagtcaggcggggggtcctcattccaatcaggccgtcgcc
ggcccaccaccgcagggcccgactgcgactcagccagctcccagcacaccagcgccgcag
ccggcccccagccccgcacctccggccacctctgccccggctcctgagtcccaaccacct
cagggtcaggctcacacctcgcccccctgccctccaggccagaccccagctgcccactcc
agctccagcactactcctgtactccatgagcccaccgcccctcttcccggggaaacactc
cacccctcggctccggtcccacctccgcagtga

DBGET integrated database retrieval system