KEGG   Larimichthys crocea (large yellow croaker): 104931578Help
Entry
104931578         CDS       T04659                                 

Gene name
neu4
Definition
(RefSeq) sialidase-4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00511  Other glycan degradation
lco00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    104931578 (neu4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    104931578 (neu4)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     104931578 (neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 104931578
NCBI-ProteinID: XP_019108392
UniProt: A0A0F8ACR3
LinkDB All DBs
Position
Un
AA seq 481 aa AA seqDB search
MRSPYFPARTVLFHKEPNGVTYRVPGLLYLSRSRTFLAFCEERLSPSDSQAHLLVMRKGT
FYRNYVEWEDMRVLGSALLPGHRSMNPCPVYDEFTGTLFLFFIAVLGHTSESYQLVTGKN
VTRLCYTCSTDDGDTWSPVTDLTKRVIGETIKEWATFALGPGHGIQLKSGRLLVPAYAYH
IECKECFGQLCQTTPHAFCFHSDTHGQTWRFGEAVPGPESVECQMVSVDEEDGTNVLYCN
ARSPLGYRVQALSLDDGAVFQQGQLVQRLVEPRNGCHGSTVGFPAPLHLCHTLNHHLHQP
IHHCRHWTSCMTDSNHTNSPSPNIKAPPDFLTPTWVVYSHPTWTNARKDLGVFLSLFPRD
PDSWRGPWVIYEGPSAYSDLAYLELPPSPGAPPAVAFACLFECGSKTAYDEICFCIFTLY
ELIDNLPRNVQLGGNKHEYKRQTSGTSQSCTSRHDAQSTAAFHQVKKRRKKSKLTEMCSV
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcaccctatttccctgcgaggacggtgcttttccacaaggagccaaacggggtg
acgtacagggttccaggactgctctacctgtccagatccaggactttcctggccttctgt
gaggagagactgagcccatcagactctcaggctcacctgctggtcatgaggaaagggacc
ttctacaggaattatgtggagtgggaggacatgcgtgtcctgggctctgccctcctgcca
ggtcaccggtccatgaacccgtgcccggtatacgatgagttcacgggcactctcttcctc
ttcttcattgctgttctcggccacacgtcagagtcctatcagctggtgacaggcaagaat
gtgacccgcctctgctacacctgcagcactgatgacggagacacctggagtcctgtcacc
gacctaaccaagagggtcatcggagagactatcaaagaatgggccactttcgccctcggt
cctggtcatggcatccagctcaagtccggtcgtctgctggttcctgcctatgcttaccac
attgagtgcaaagagtgctttggacagctctgccagaccaccccacacgccttctgcttc
cacagtgacacccacgggcagacctggcgtttcggtgaggcggtgccggggcccgagagc
gtggagtgtcagatggtgtctgtggatgaagaggatgggactaacgtgttgtactgtaat
gcacgcagccctcttggatacagggtgcaggccctcagtctggatgatggagcggtgttt
cagcaggggcagctggtgcagcggctggtggagcctcgaaatggttgtcatggtagcact
gtgggatttcctgccccgttacatttgtgtcatactcttaaccatcacttacaccaacct
atacatcactgcagacactggacgtcctgcatgacagactcaaaccacaccaactctcca
tctccaaacatcaaagcccctccagacttcctcacccccacctgggtggtgtactcccac
ccaacgtggaccaacgcccgcaaggatctgggtgtgttcctcagcttatttccccgggat
ccagacagttggcgtggcccctgggtgatctacgagggccccagcgcctactcagacctc
gcctatctggagttgccaccctcacctggggcaccgcccgctgtggccttcgcctgcctg
tttgagtgcggcagcaagacagcttacgacgagatctgcttctgcatcttcaccctctac
gagcttattgataacctgccccgaaatgtgcagctgggaggtaacaaacatgaatataaa
agacaaacctctgggacaagtcagagttgtacaagcagacatgatgctcagagtacagct
gcttttcatcaggtgaagaagaggaggaagaagagcaaactgactgagatgtgctctgtg
tcttaa

DBGET integrated database retrieval system