KEGG   Larimichthys crocea (large yellow croaker): 104931751Help
Entry
104931751         CDS       T04659                                 

Gene name
met
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04510  Focal adhesion
lco04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104931751 (met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104931751 (met)
   04520 Adherens junction
    104931751 (met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104931751 (met)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104931751 (met)
Protein kinases [BR:lco01001]
 Receptor tyrosine kinases (RTK)
  MET family
   104931751 (met)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104931751
NCBI-ProteinID: XP_019117046
UniProt: A0A0F8AMW9
LinkDB All DBs
Position
X
AA seq 1419 aa AA seqDB search
MNPRSLHAVMLLWALCPSAQGQCDKSPETNKLNLSVTYELPTFTADFPIQNMVTLDGIIY
VGAVNRIYALAPNLTKLSEYHTGPLLPNQTCGQTLTSSGRVDNNNIALVVENIYDKGLYS
CGSADNGVCRRHVLDDDVSPKTVDEEVYCFADKVRQGKGHPIDSDVVVSPSGSQVLNVES
NVITFFVGNSEIPGIGNIAGSATHPHTISLRKMKTSQNGFTFFSNHSHMDLIPSLRGNYY
LKYVYSFHSGPFTYFLTVQRVSKDSQAYHTRIVRMCSSDLVIRRYVEMPLECISTDKRRR
RSTEDVKVFNILQAAHVTKVGSDVELQRQLKVEEGDDVLFAAFARGKPNSPEPTPNSAVC
IMSLKHINNMFKMYMQRCNTVDPYHFTGSDKKSCYNVTSSDDCDAHEGIHEGKEGKYHLQ
VTQFVQRLEYWHKELTNTLVTSITVLPVHGRAVAYLGTADGRHIQVLFSRFASPHVNIHL
DPRPVSASVALLDTEHSEGALLMATGNKITKVPLIGPGCGQLTTCTSCLLASRVTECGWC
DGRCTRANQCPSFSHWTQDYCTPVITKIFPTSGPIRGNTLVTMCGRNFGFDKTESFKASL
VSVEVAGAPCKLPRQDNINRWTEMHCSPVFNGNFTPSGHTVKVISGQKVAKMEGFTFVDP
VIHEIFPTFGPKSGNTMLTIRGAFLDTGNKREVMIGKAVCKIQSLSSSMLTCKTPPHAVP
SKQPVKLTVDSVERLAPVMFTYNQDPIINSIQPSRSFVSGGCTVAAHGFFLQSGLQPQMV
LTTGQDAEVFHVSCVYGENRTSIQCTTPSLAKLALQPPVVTKVAFVLDGYSTEQWDLIYV
EDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLILVGNTLECTVPTE
LQAAPAKELQVEWRQADSIRHLGKVTLAQEQDYTGLIVGCVCVSALLLLLGTLLMWRRNK
HIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTTLLEDQGTDRPETCRA
APPIYGGNGELLSPRLGALGGGMGLGMEGELVSPLLMAPVHIDPSCLHPDLLTEVQHVVI
AREQLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVSQFLKEGIIM
KDFSHPNVLSLLGICLPPEGSPLVVLPYMKHGDLRNFIRDEGHNPTVKDLMGFGLQVARG
MEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSGVKLPVKWMA
LESLQTHKFTTKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRLLQPEFCPDA
LYTVMIECWHPKPERRPSFSELVARISAIFSSFSGEHYVLLNTTYVNIDKMSPYPSLLAS
TSTGTTASFSSSSSSDPTTSTSLPTQSPLFCHVERECCT
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacgctcactacatgctgtcatgctgctgtgggctctgtgccccagtgcgcag
ggccagtgtgataaatcacccgagaccaacaaactcaacctctcagtcacctacgagctt
ccaacgtttactgcagacttccccatccagaacatggtgacactggatgggatcatctac
gttggagctgtaaacagaatctatgccctggccccgaacctcacaaagctgtcagagtac
catacagggccactgcttcccaaccagacttgtggccagacactgaccagcagtggcagg
gtggacaacaacaacattgccttggtggtggagaacatttacgacaaggggttatacagc
tgcggctcggcagacaatggtgtttgccgccgtcacgtgcttgatgatgacgttagcccg
aaaaccgtagacgaagaggtctactgtttcgctgacaaggtgaggcaaggcaagggtcat
cccatcgactcagatgttgtggtcagcccttcaggctctcaggtgctcaatgtggagagc
aacgtcatcacgttttttgttgggaactctgagatcccaggcataggaaacatagcaggc
agtgcaacacacccccataccatttctctgcggaagatgaagacaagccaaaatggtttc
actttcttctccaaccactcacacatggacttgattccatctctacgtggaaactactac
ctgaaatatgtttactccttccacagtggaccattcacctacttcctcacagtgcaacgg
gtgagcaaggactcccaggcctaccacactcgcatagtccgtatgtgctcctcggacctt
gtgatccgccgttacgtggaaatgccccttgaatgcatcagtaccgataaaagacgacgg
cgttccacagaagatgtgaaggtattcaacatactccaagcagcccatgtcaccaaggtg
ggcagtgacgttgagctgcagagacagctgaaagtggaggaaggtgatgatgtgctgttt
gctgcctttgcccggggaaagccgaactctccggagccgacccctaactcagccgtctgc
atcatgtccctgaaacacatcaacaacatgttcaagatgtacatgcagaggtgcaacaca
gtagacccatatcacttcactggatcagacaagaagtcctgctacaatgtgacctcatca
gacgactgcgatgcccatgagggaatccatgaaggtaaagagggcaagtaccacctgcag
gtgacccagtttgtccaaaggttggagtactggcacaaagagttgacgaacaccttggtt
acgtctatcactgtgttgccggtccatggccgtgcagtggcatacctgggcactgcagac
ggacggcacatacaggtgctgttctcccgatttgcctctcctcatgtaaacatccacctg
gacccgagacctgtgtctgccagtgtagcgctgctggacacagaacactcagagggagcc
ctgctaatggccactggaaacaagattactaaggtccctctgattggccctggctgtggt
cagctgaccacttgtacttcctgtttgttggcgtcgcgggtgacagaatgcggctggtgt
gatggacgctgcaccagagccaaccagtgtccctccttctcccactggacccaggactac
tgcacacctgtcatcactaagatttttccgacctctggaccaatacgaggcaacacatta
gtgacaatgtgcgggcgcaacttcggcttcgacaagacggagagcttcaaggcttctctg
gtatcagtggaagtagcgggagctccatgcaaactgccgagacaagacaatatcaacagg
tggactgagatgcactgttccccagtattcaatggaaacttcaccccatcaggacataca
gtgaaggtcatcagtggccaaaaggtggccaagatggagggcttcacctttgtggaccct
gtgattcacgaaatcttcccaacatttgggccgaagtccggcaacaccatgctgaccatc
agaggagccttccttgatactggaaacaagcgagaggtgatgatagggaaagcagtctgt
aagatccagagcttgtcatcgagcatgctgacatgcaagacacctccacacgctgttccc
tccaagcaacccgtgaagctgacggtggattctgtggagcgcctcgcccctgtgatgttc
acctacaaccaagaccccatcatcaacagcatccagccctcacgctccttcgtcagcgga
ggctgcacggtggccgctcatggcttctttctccagtccggcctccagccccagatggtc
ctcaccaccggtcaggatgctgaggtctttcatgtgagctgtgtgtatggtgagaaccgg
acatccatccagtgcaccacaccttctctggccaaactagctcttcagccacccgttgtc
accaaggtggcattcgtcctggatggctactccacagagcagtgggatctgatctatgtc
gaggaccctcttttccaggaccccaagctcacctcaaaggacaacaagagcattgtggag
ctcaagggtgaccggatggacagggaggccatgaaatgtcaagttctgactgtttccaac
catagctgtgagagtctgattctagttggaaacactctggagtgcacagtgcccaccgag
cttcaggctgcccctgccaaagagctgcaggttgagtggcgacaggcggactccatcagg
cacctgggcaaggtgacgctggctcaggagcaggactacacaggcctcattgtgggctgc
gtgtgtgtcagcgcgctgttgctgcttctgggaactctgctcatgtggaggaggaacaaa
cacattgatgatctgtctgaggtgtggtatgatggccggggtcacatccagcatctggac
aggctggctaatgcgaggagcgtcagccccactaacgaaatggtctcccacgagtcagtc
gactatagaacaaccctgctggaggatcagggcactgacaggccagagacatgtcgggca
gctcctcccatctatggaggtaatggggagctgttgtctcccagactgggggcactggga
ggtgggatgggtctgggaatggagggcgagctggtgtcacccctactgatggccccagtc
cacatcgacccatcctgtctccacccagacctactaacggaggtgcagcacgtggtgatc
gccagggagcagctgttgctccacctcaaccaggtcatcggcagaggtcacttcggttgt
gttttccatggaactctgctggagccagacggccaaaagcagcactgtgctgtcaagtcc
ctgaaccgcatcacagatctggaagaggtgtcccagttcctgaaggaggggatcatcatg
aaggacttcagccaccccaacgttctctctctgctggggatctgcctgccgccagagggt
tcaccactggtggttctgccctacatgaagcatggcgacctgcgcaactttatccgagat
gagggacataacccgacagtgaaggatctgatgggcttcgggctgcaggtggccagagga
atggagtatctggccagcaagaagtttgtccatcgagacttagctgccaggaactgcatg
ctggatgagagctacacggtgaaggtggcagacttcggcctggctcgagacgtttatgat
aaagaatattacagtgtccacaacaagagtggagtcaagctgcccgtcaaatggatggct
ctggagagtctgcagacacacaagttcaccaccaagtcggatgtgtggtcgtttggcgtg
ttgctatgggaactgatgacccgtggagccccaccatattctgatgtgaactccttcgac
atcaccgtgttcctcttgcaggggaggaggctgctgcagcctgagttctgtcctgatgcc
ctctacacggtgatgatcgagtgctggcatccaaagccagagcggcgtccctccttctcc
gagctagtggcgcgcatctccgccatcttctccagcttcagcggggagcactacgtgctg
ctcaacaccacctacgtcaacatcgacaagatgagcccttacccctccctcctcgcctcc
acctccaccggcaccaccgcctccttctcttcgtcttcctcatcggaccccaccacctcc
acgtccctgcccacccaatcccccctcttttgccacgtggagagggaatgctgcacctga

DBGET integrated database retrieval system