KEGG   Larimichthys crocea (large yellow croaker): 104931879
Entry
104931879         CDS       T04659                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104931879 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104931879 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104931879 (kitlg)
Cytokines and growth factors [BR:lco04052]
 Growth factors
  Growth factors (RTK binding)
   104931879 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 104931879
NCBI-ProteinID: XP_027139402
LinkDB
Position
X
AA seq 274 aa
MPHAISLYRVAKIWIRICVHLLLFITLGVHSSKFDVNPVTDDISRLSILRQNIPKDYKIP
VHYVPKEEGGMCWVKLNVFYLEESLKDLAHKFGNISSNRKDISIFIQMLQELRLNSRTVD
PIMYDFECHYRKERWQTARYFDFVKDFLIAVQNREDKDDCDPPPCPTTPLTVTTEVTIKV
NTSTSKHECTTGCKPPHEPRILPEVVERSLLFLLFIPLIALVFLLVWKVRSRRNEDDLQQ
NPGEDGLFTGREGNAPQLDPEISEKNKLNVIEPV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgccacacgccattagcctatacagggttgcaaagatttggatacgcatttgtgtccat
ttactgctgttcatcacgcttggggtacattcaagtaaatttgacgtcaacccagtgaca
gatgacatctcgagactctctattttgagacaaaatattcctaaagattacaaaattcct
gtacattacgttccaaaagaagagggtgggatgtgttgggtaaaattaaatgttttctac
ttggaggagagtttaaaagatttagcacataagtttggaaacatttcatccaacagaaaa
gatattagcatattcatccaaatgctccaagaactgcggctcaactcaagaactgtggat
ccgatcatgtatgattttgagtgccactacaggaaagagaggtggcagacagcgcgatac
tttgactttgtcaaagactttcttatagctgtacagaacagagaagataaagatgactgt
gatcctcctccctgtcccaccacaccactcacagtaacaacagaagtaactattaaagta
aacacgtccaccagtaaacacgagtgtacaacaggctgcaaaccacctcatgaaccgcgg
atcctgcctgaggtggtggagcgaagccttctcttcttactgttcattccactcatagcc
ctggtattcctgcttgtgtggaaggtccgatcacggaggaacgaagacgatcttcaacag
aatcctggtgaagatggactcttcacaggaagagaagggaatgcgcctcaactagatcct
gaaatatcggaaaaaaacaagttgaacgtcattgaaccagtgtaa

DBGET integrated database retrieval system