KEGG   Larimichthys crocea (large yellow croaker): 104932598
Entry
104932598         CDS       T04659                                 

Definition
(RefSeq) uncharacterized protein LOC104932598
  KO
K05461  KIT ligand
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104932598
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104932598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104932598
Cytokines and growth factors [BR:lco04052]
 Growth factors
  Growth factors (RTK binding)
   104932598
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 104932598
NCBI-ProteinID: XP_019132435
LinkDB
Position
XX
AA seq 250 aa
MRKKILKAPCLFLSLFTSLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEESLCKLGNMFGAISSNKENIIVFIAMLKSLRFTFDHEELETAMQVFQ
CHYQEGRLMSGLYFDYIKDVLQTASEGTSGFSCKPPPCNARQPGGQEKGREYSWSRAPLL
LTLIPFTACVIILVWLVKSGRRLPLCNTENNQMAPSDMIPTVSISIPLQTLTHTADTQPV
GEAIPEHESG
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcttcttgagtctgttcacaagtttgaat
ctctgctctgggaaatttgggacaccgatcactgatgatgtgagcaagctgtcgttattg
aagcagaatatcccctctgattatgagattcctgttagttacattcccaaagaagtggct
ggcacgtgctgggtggtgttaaatatctatcctttggaggaaagtctttgtaagctcggc
aacatgtttggcgccatctcctccaacaaagaaaacataattgtcttcattgccatgctg
aagagtttacgcttcacctttgaccacgaggaactggaaacggcgatgcaagtcttccag
tgtcactatcaggaagggcgcctaatgtctggtctttatttcgactacatcaaagacgtc
ttacaaaccgcctctgaaggaacatcaggcttctcgtgcaagccgccaccgtgcaatgca
cgacaaccagggggtcaggagaagggtcgtgaatacagctggtcgagagctcccttgctg
ctgactctcatcccctttacagcttgtgttattatcctagtgtggctggtgaagtctgga
aggcgtttaccactttgcaacactgaaaataaccaaatggcaccttctgacatgatccca
actgtgtctatctccatcccgcttcaaacgctcacccacactgctgacactcagccagtg
ggggaggcgatccctgaacacgagagtggatga

DBGET integrated database retrieval system