KEGG   Larimichthys crocea (large yellow croaker): 104932780Help
Entry
104932780         CDS       T04659                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00010  Glycolysis / Gluconeogenesis
lco00051  Fructose and mannose metabolism
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco00520  Amino sugar and nucleotide sugar metabolism
lco00524  Neomycin, kanamycin and gentamicin biosynthesis
lco01100  Metabolic pathways
lco01200  Carbon metabolism
lco04910  Insulin signaling pathway
Module
lco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104932780
   00051 Fructose and mannose metabolism
    104932780
   00052 Galactose metabolism
    104932780
   00500 Starch and sucrose metabolism
    104932780
   00520 Amino sugar and nucleotide sugar metabolism
    104932780
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104932780
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104932780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lco04131]
    104932780
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104932780
Membrane trafficking [BR:lco04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104932780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 104932780
NCBI-ProteinID: XP_019117412
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDIMNRFRREMENGLGRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTHDKKQPVQMESQVYDTPDDIIH
GSGSRLFDHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQSKLDEAVLLTWTKKFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGSFGDNGSIEDIRTEFDREIDRGSINPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVQHVCTIVSFRSANLIASTLGGILSRLKENKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSAKGAAMVTAVAYRLTEQARQIQQTMAEFRLS
KAQLLEVKKRMRVEIERGLKKDSHKEATVKMLPTFVRTTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEMENPEFELDVVAIVN
DTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEETKNIEIVEGNEGRMCVNMEWGAFGDNG
CLDDIRTRYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGA
GMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIFQQTVKELAPKCDVNFLLSEDG
SGKGAALITAVGCRQRELEAQQH
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagctcagcttttggcctactacttcaccgagttgaaggatgatcaactcaaa
aagattgataagtatctgtactccatgcggttctcggatgagacgctgaaggacatcatg
aaccggttccgcagggaaatggagaacgggctcggccgtgacaccaaccctactgccact
gtcaagatgctgcccacttttgtcaggtccatccctgatggatcagaaaagggggacttc
atagctctggaccttgggggatcgaactttcggatcctgcgtgtcaaagtgacacatgac
aaaaagcagccagtccaaatggagagccaggtctatgacacccctgatgacatcatccat
ggcagcgggtcacggctctttgaccatgttgcagattgcctgggcgacttcatggagaag
caaaaaatcaaggataaaaagcttcctgtaggatttacgttctccttcccctgtgcccaa
tccaaactagatgaggcagtcttactgacatggacaaagaagtttaaagccagtggggtc
gaaggcatggatgtcgtgaagcttctgaacaaagccatcaagaaacgaggggactatgag
gcagacatcatggcggtggtgaatgacacagttggtaccatgatgacctgtggatttgac
gatcagcgctgtgaagtcggcatcatcatagggacaggaacaaatgcctgttacatggag
gaattgcgtcatattgatctggtggaaggagatgaagggcgaatgtgcatcaacacagag
tggggttccttcggggataacggatccatagaagacattcgcacagagtttgaccgagag
atcgacagggggtctatcaacccaggaaagcagctgtttgaaaagatggccagtgggatg
tacatgggtgagctggttcgactcatcctggtaaagatggcaaaagagggactgctgttt
gagggacgaataacacctgagctcctgacaaaaggaaagattgagacaaaacatgtttct
gccattgaaaagaccaaagaaggactgaagaagtgtatggaaatcctgacaaggctcggg
gtggagccttcagatgaagactgtctggctgtgcagcatgtgtgcaccatcgtatccttt
cgctcagcaaatctaattgcttcaacactgggaggcattctctctcgcctaaaggaaaac
aaaggagttgcacgcctccgcaccactgtgggcatcgatggttctctctacaagatgcac
cctcaatatgctcgccgtctgcacaagacagtgcgtcgcttggtcccagactcagatgtc
cgcttcctgctgtctgagagtgggagtgcgaaaggcgcagccatggtgacagcagtggcg
taccgtttgacagaacaggcacgccagattcagcagactatggcagaattcaggctgagc
aaagcccagctgttagaagtgaagaaacgcatgagggtggagattgaaagaggcctcaaa
aaggacagccacaaggaggcgacggtcaaaatgttgccaacctttgtccgaactacacca
gatggaacagagaatggagatttcctcgctctggatctcggagggacaaactttcgtgtg
cttctggtaaagattcgcagcgggaagaggcgaacagtggagatgcataacaaaatctat
gccatacccatagaagtcatgcagggcacaggagaagagctctttgaccacattgtgcac
tgcatttctgacttcctggactacatgggaatgaaaagtgctcgactgccgctgggtttc
accttctccttcccctgccatcagaccagtttggacgcaggtatcctcgtaacctggacc
aaaggcttcaaggccacagactgtgagggtgaggatgtggtggagcttcttcgcgaagca
atcaagaggaaagagatggagaatccagagtttgagctggatgtggttgccatagtgaac
gacacagtgggaacgatgatgacatgtgcatatgaggaacccacctgtgaagtggggctg
atcgcagggacaggcagtaacgcctgttacatggaggagacaaagaacattgagatagtg
gagggtaacgaaggccgcatgtgtgtcaatatggagtggggagcttttggagacaacggc
tgtctggatgacatcaggacgagatacgaccaggcggtggacgagaactccctcaatgaa
ggcaaacaaagatatgagaagatgtgcagtggtatgtacctcggagagatcgtcaggcag
atcttgattgatctgaccaagcgtggcttcctcttccgaggacaaatctcggagacgttg
aagaccaggggcatcttcgagacaaagttcctgtcacagatagagagcgatcgtctggcg
ctactgcaggtcagggcgatcctgcaacagctggggctcgacagcacctgtgatgacagt
attatcgtcaaggaggtgtgtggcacggtgtcccgccgtgcggctcagatctgcggagcc
ggtatggctgctgtggtggacaagatccgtgagaacagaggattggaccacctggatatt
accgtgggcgtggatggcacactctacaagctgcacccacacttctctcggatcttccag
cagacagtgaaggaacttgccccaaaatgtgatgtcaacttcctgctatcggaggacggc
agcggcaaaggggctgcgctcatcacagccgtgggctgccgccagagggagttggaggcg
cagcagcactaa

DBGET integrated database retrieval system