KEGG   Larimichthys crocea (large yellow croaker): 104932794Help
Entry
104932794         CDS       T04659                                 

Gene name
suv39h1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104932794 (suv39h1)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104932794 (suv39h1)
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104932794 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    104932794 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 104932794
NCBI-ProteinID: XP_010746405
UniProt: A0A0F8B9K6
LinkDB All DBs
Position
Un
AA seq 426 aa AA seqDB search
MAENLKASGTIGGHLNGAVASGCGVPCKMSWEELEALCRTERLQCKQLGVSRANINDYEV
EFLCDYKKSKEEEFYLVKWRGFPDSENTWEPKKNLKCRILMKQFHLDLEKELMRHKRRCT
PKRLDKEVVSFLTQKAKHRQSLQRWEAHLNRTRNHPGRIFVMNEVDFEGPPKNFTYINNY
KVGQGIVLDEMAVGCECKNCLEEPVNGCCPGASLHRMAYNDKGQVRVRPGQPIYECNTQC
SCGPDCPNRVVQKGIQFDLCIFKTENGRGWGVRTLQHIKKNTFVMEYVGEIITTDEAERR
GQVYDRQGSTYLFDLDYVEDVYTVDAAHQGNISHFVNHSCDPNLQVFNVFIDNIDERLPR
IALFSTRSIRAGEELTFDYKMQIDPMDTESTKMDSSFSLAGLPSSPKKRIRVECRCGTDP
CRKYLF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagcttcagggacgatcggcggtcatttaaacggagcggtggcg
tcaggctgcggcgtgccctgtaagatgtcctgggaggagctggaagccctgtgccgcacg
gagaggctccagtgtaagcagctcggggtgagcagagccaacatcaacgactatgaagtg
gagtttctctgtgactacaagaagagcaaggaggaggagttctatctggtgaagtggagg
ggtttcccagattcagaaaacacgtgggaacccaagaaaaacctcaaatgtcgcatactg
atgaagcagttccacctggacctggagaaggagctgatgcgccacaagagacgatgcact
cctaaaaggctggataaggaagttgtctctttcttgacccagaaagccaaacaccgtcag
agtctgcagcggtgggaggctcatttgaaccggactcgcaaccacccgggtcgcattttt
gtcatgaatgaagtggacttcgagggccctccaaaaaacttcacctacatcaacaactac
aaagtaggccagggcatcgtgttagatgagatggctgtgggttgtgagtgtaagaactgt
ttagaagagccggtaaatggctgctgccctggggcctcactgcaccgcatggcctacaat
gacaagggtcaggtgcgggtccgaccgggtcagcccatatacgagtgtaacacccagtgc
agctgtggccccgattgtcctaacagagtggtgcagaagggcatccagtttgacctgtgc
atctttaagacagagaatggacgggggtggggtgtccgcaccctgcagcacatcaagaag
aacacattcgtcatggagtacgtgggagagatcatcacaacagatgaagcagagaggagg
ggtcaagtgtatgaccgccaaggatccacatacctctttgacctggactatgtggaggac
gtgtatacagtggatgcagctcaccaaggcaacatctcccactttgttaaccacagttgt
gatcccaacctgcaggtatttaatgtgttcatcgacaacattgacgagaggcttccaaga
attgctttattttcaacacggtcgattcgggctggagaggaactcacctttgactacaag
atgcaaattgatccaatggacacagaaagcaccaaaatggactcgagtttcagtctagcg
gggctccccagctctccaaagaagaggattcgagtggagtgtcggtgtggaacagacccg
tgtcgaaaatatctgttctga

DBGET integrated database retrieval system