KEGG   Larimichthys crocea (large yellow croaker): 104932813Help
Entry
104932813         CDS       T04659                                 

Definition
(RefSeq) tetraspanin-5-like isoform X3
  KO
K17345  tetraspanin-5
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104932813
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104932813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF3883
Motif
Other DBs
NCBI-GeneID: 104932813
NCBI-ProteinID: XP_010746429
LinkDB All DBs
Position
XIV
AA seq 276 aa AA seqDB search
MSGNHFKGHEVSCCIKYFIFGFNILFWLLGMALVGIGLWAWSEKGVLSNISSITDLGGLD
PVWLFMVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTTGVLAFVFKDWIK
DQLNLFINNNIRAYRDDIDLQNLIDFTQEYWECCGAFGADDWNLNIYFNCTDGNPSREKC
GVPFSCCTKDPAEDVINTQCGYDIRAKPDSEQKDYINVKGCVPQFEKWLQDNLTLVAGIF
IGVALLQIFGICLAQNLVSDIEAVQASCSRSLNAPP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaatcatttcaaaggccacgaagtcagctgctgcatcaaatacttcattttt
ggattcaacatcctgttctggctgctgggcatggccttggttggaattggactgtgggca
tggagtgagaagggggttctgtccaacatctcttccatcacagacctcgggggcctggac
ccagtctggctgttcatggtggtcgggggggtcatgttcattctgggctttgcaggatgc
atcggagccctcagagaaaacacatttctactcaagtttttctccgtgttcctgggaatc
atcttcttcttggagttgacgacgggagtcctggcatttgtcttcaaggactggatcaaa
gatcagctcaacctgttcatcaacaacaacatccgggcgtaccgggacgacattgatctc
cagaacctcattgatttcacccaggaatattgggagtgctgtggggcgtttggagcagac
gactggaacctgaacatctactttaactgcactgacgggaaccccagccgggaaaagtgt
ggcgttcccttctcgtgctgcaccaaggacccagcggaggacgtgataaacactcagtgt
ggatacgacattcgagctaagccagactccgagcagaaggactacatcaacgtgaaaggc
tgcgtgccgcagttcgagaagtggctgcaggacaacctcaccttggtggccgggatattt
ataggagttgcactactgcagatttttggcatttgtttggcccaaaacttagtgagcgac
atcgaagctgtgcaggcgagctgctccaggtctttgaacgcacctccttga

DBGET integrated database retrieval system