KEGG   Larimichthys crocea (large yellow croaker): 104932935
Entry
104932935         CDS       T04659                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104932935 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lco04052]
    104932935 (epo)
Cytokines and growth factors [BR:lco04052]
 Cytokines
  CSF and other factors
   104932935 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 104932935
NCBI-ProteinID: XP_010746579
UniProt: A0A6G0HIN4
LinkDB
Position
XIV
AA seq 185 aa
MLQKTGRGLLALLLIVLEWTRPSLPSPLRPICDLRVLNHFIKEARDAEVAMKSCREGCSL
SESVTVPQTRVEFDVWEKKNALEQAQEVQSGLWLLQQALNLLRTSVTNTALHSHIDNSIR
NLVSINAVLRSLNIQEYTPPASAAGLEGTWTASSATDLLQVHVNFLRGKVRLLLLDAQAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcagaaaacgggtagaggattgcttgccttgctgttgatagtgttggagtggacc
cggccaagtctaccatcaccgctgaggccaatctgtgacctgagggtcttgaaccatttc
attaaggaagcacgagacgcagaagtcgctatgaagtcatgtagagaaggatgtagcctg
tcagagtctgtcactgttccccaaaccagagttgaatttgatgtctgggagaagaaaaat
gcattggagcaagcccaggaggtccagtctggtttatggctcctacaacaggccctcaac
ttgctacggacctcagtcaccaacacagcactgcacagccacatagataactccatcaga
aacctggtcagcattaatgctgtgctgcgtagcctcaacatccaggaatataccccacca
gcaagtgctgcagggcttgagggaacatggacggcgtcctccgcaacagatttgcttcaa
gtccatgtcaacttcttgcgaggcaaagtgcgcctcctccttttggatgcgcaggcttgt
cagcaagatgtcagctga

DBGET integrated database retrieval system