KEGG   Larimichthys crocea (large yellow croaker): 104933360
Entry
104933360         CDS       T04659                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
lco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104933360
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104933360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lco04030]
    104933360
G protein-coupled receptors [BR:lco04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    104933360
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Claudin_2 DUF1634
Other DBs
NCBI-GeneID: 104933360
NCBI-ProteinID: XP_010747084
LinkDB
Position
X
AA seq 370 aa
MAMPTDNPEQCYDNESVKFFYEKSGKNISDHWRRRDYVIVTLGMTVCFIVIFSNLLVIAA
IFKNRRFHFPIYYLLGNLALADLFSGISYLHMMFHTGPWTIKLSVHQWFVRQGLIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSKMSTRRVFIIMLFIWLVAIIMGLVPTMGWHCLCDLE
NCSTMAPMYSRSYLVFWAILNLLTFSIMLAVYTRIFIYVRHKSKQMSQHTTQMRHKETVF
NLMKTVSMILGCFVICWTPGLVVLLLDGLHCDVCKVLLYEKYFLVLAECNSFVNPIIYCF
RDKDMRRTFMELLCLCRRGGKSKNASGVHFSTLEHENYKSRKAEPMERSNGTPLIHEVSE
DMPVSSEKWN
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcaatgccgactgacaacccagaacaatgctacgacaacgagtctgtcaagtttttt
tatgagaaaagtggaaagaacatcagcgaccactggcgcagacgtgactatgtgattgtc
actcttggcatgacggtctgcttcattgtcattttttccaaccttttggtcatagctgcc
attttcaagaaccgacgctttcactttcccatctactacctgttgggtaacctggccttg
gcagacctcttctcaggtatctcctacctccacatgatgtttcatactggtccctggaca
attaagctgtctgtacaccagtggtttgtgcgacagggactgattgacaccagcttgaca
gcttcagtcctcaatctcctggctgtggccgtggagcgccaccaaaccatcttcaacatg
cagctgcacagtaagatgagcacccggcgtgttttcatcatcatgttgttcatctggctg
gtggccataatcatgggtctggttcccaccatgggctggcactgcctgtgtgacctggag
aactgctccaccatggcacccatgtacagccgcagctacctggtgttctgggccattctc
aacctgctgaccttctccatcatgttggccgtctacacccggatctttatatacgtgagg
cacaagagcaagcagatgtcgcagcacaccacccagatgagacataaagagacggttttc
aacctgatgaagaccgtctccatgatcttgggctgttttgtgatctgctggacgcccggc
ctggtggtgctgcttctcgacggccttcactgcgacgtgtgtaaggtgctgctctacgaa
aagtacttcctggtcctggctgagtgcaactccttcgtcaatcccatcatctactgcttc
agggacaaggacatgaggaggaccttcatggagctcttgtgcctgtgtcggcggggagga
aagagcaagaacgcctctggagttcactttagcaccctggagcacgagaactataaaagt
cgtaaagccgagccgatggaaaggagcaacgggacgcctctcatccatgaagtctcagaa
gacatgccggtctcctcagaaaagtggaattaa

DBGET integrated database retrieval system