KEGG   Larimichthys crocea (large yellow croaker): 104933542Help
Entry
104933542         CDS       T04659                                 

Gene name
slc12a6
Definition
(RefSeq) solute carrier family 12 member 6 isoform X1
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lco02000]
    104933542 (slc12a6)
Transporters [BR:lco02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   104933542 (slc12a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12
Motif
Other DBs
NCBI-GeneID: 104933542
NCBI-ProteinID: XP_027143651
LinkDB All DBs
Position
XIV
AA seq 1212 aa AA seqDB search
MASVRFTVTPTKAEDLPGLSDTSPDISSRSGARVRFGSRESVNRSDPLSEASGGITTVGG
ADTPDHSSVDHGDGNSKISSVYINNTHGMDDDDFYDRNLALFEEEMDTRPKVSSLLNRLA
NYTNLTQGAKEHEEAESIGEKKKTSKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGSA
GVLQGLCIVFICCCCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLG
TTFAGAMYILGAVEILLMYIAPKAAIFESKQPEGEGAAMLNNMRVYGSICLLLMSLLVFV
GVKYVNKLASIFLACVIVSIVSIYIGALVSAFMPPQFPVCMLGNRTISGHEIDDSQCAKT
ILLQIKESAEGVDANFTFIHENDTVGPTFDPSPSTILVETTYLWKHFCQGPELNASCDKY
FTSNNFSEIDGIPGLASGIISENLWSSYLSKGDVVEKGSLKSSHDAQPASNHQPYVFADI
TTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGAC
IDGVVLRDKFGDSVKGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD
NIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDLVAPILTMFFLMCYLFVNLAC
GLQTLLRTPNWRPRFSYYHWTLSFLGMTICLALMFISSWYYAIVAMVIAGMIYKYIEYHG
AEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLDEDAHVKSPRLLTFAS
QLKAGKGLTIVGTVVSGNFLQSYGEALAAEQTLKHLMDKERVKGFCQCIVAQKPREGISH
MIQSSGLGGMKPNTVVMGWPHAWRQSEDPQSWKTFINTVRVTTAAHLALLVPKNISLFPS
NSEPCTEGYIDVWWIVHDGGMLMLLPFLLRQHKVWRKCGMRIFTVAQMEDNSIQMKKDLA
TFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRQMRLSKSDREREGNPGSSS
SRPEAGGATRSQVYLFPRYRSTGVHTSNTCKGNRDRQAQLVKDRNSMLRLTSIGSDDDDD
TDGGDRDRPTSSGGGGGSSEHQRRVQMTWTKERTSQYRATHSGCSTPEGFRDMLSIRPDH
SNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNTEGDENYMEFLEVLTEGLERVLLV
RGGGSEVITIYS
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggtgcgcttcacggtgacccccacgaaggcggaagatctcccggggctgtcc
gacacgtcgcccgacatcagctcccgctcaggggcgcgagtccgcttcggctccagggag
agcgtgaaccggagcgacccgctcagcgaggcgtcgggaggcatcacgacggtcggaggg
gccgacacgccggatcacagcagcgtggatcatggtgatggaaactccaaaatctccagc
gtgtacatcaacaacacccacggcatggacgacgacgacttctacgaccgaaacttggcc
ttatttgaggaggagatggacactcggccgaaggtgtcgtctctgctcaatcgcctggcc
aactacaccaacctgacgcagggcgccaaggagcacgaggaggccgagagcatcggagag
aagaagaaaaccagcaagtcgccacagatggggacgttcatgggcgtttacctgccttgc
ctccagaacatcttcggcgtcatcctcttcctgaggttgacgtgggtggtgggatcagct
ggagtgctgcagggcctctgcattgtcttcatatgctgctgctgcacgatgttgaccgct
atatcgatgagtgcaatcgccacgaatggagttgtaccagcgggaggcgcctacttcatg
atcagtcgctctttgggtccagagtttgggggggcggtgggcctgtgtttctacttggga
accaccttcgccggagccatgtacatcctgggagccgttgagatcctgctgatgtacatc
gcacctaaagcagccatatttgagtcgaagcaacccgaaggcgaaggggcggcgatgttg
aacaacatgcgtgtctacggctccatctgtctcctcctgatgtccttgttggttttcgtc
ggcgtgaagtacgtcaacaaactggcctccatcttcttggcctgcgtcatcgtctccatc
gtctccatctacatcggagcgctggtctccgccttcatgccgccacaattccccgtgtgc
atgctgggaaacagaaccatcagcggccacgaaatagatgacagccagtgcgccaaaacc
atcctgctgcagatcaaagagtcggcggagggagtcgacgccaacttcacctttattcac
gaaaacgacaccgtgggcccgacctttgaccccagcccttctaccattctggtggagacc
acatatctttggaagcatttctgccagggccctgaactcaacgcctcctgcgacaaatac
ttcacgtccaacaatttctcagagatcgacgggattcccggcctggccagtgggatcata
tcagagaacctgtggagctcttacctcagcaaaggtgacgtggtggagaaaggttccctg
aaatcgtctcacgacgcacagccggcgtccaatcatcagccgtacgtgttcgccgacatc
accacctccttcacgctgctggtgggcatcttcttcccatccgtcacaggaatcatggct
ggttcaaaccggtcgggggatctgaaagacgcccagcgctccatccccatcggaaccatc
ctcgccatcctcaccacctccatcgtctacctgagcagcgtcgttttgttcggcgcctgc
atcgacggggtcgtcctcagagacaagtttggagactccgttaaagggaatctggtggtg
ggcactctggcttggccgtctccctgggtcatcgtgatcggctctttcttctcgacatgc
ggcgctggcctccagtcgctgaccggtgctccccgactcctgcaggccatcgccaaggac
aacatcatccccttcctcagggtgtttggccatgggaaggctaacggggagcccacctgg
gccttgctgctgaccgccctgatagctgagctggggatcctcatcgcttctctggacctg
gtggctcccatcctcacaatgttcttcctgatgtgttacctgttcgtgaacctggcttgc
ggcctgcagacgctcctgaggacgcccaactggaggccgcgcttttcctattaccactgg
accttgtcatttttggggatgactatctgcctggcgctcatgttcatatcctcttggtac
tacgcaatcgttgccatggtgatcgccggcatgatctacaagtacattgagtaccacgga
gcagagaaagagtggggggatgggatccgcggtctctcgctcagcgctgcccgttacgcc
ctcctgaggttggaggagggaccgccgcacaccaaaaactggaggcctcaggtgctggtc
ttactaaaactggacgaagacgcccacgtcaagtctcctcgcctgctgacgttcgccagc
cagctgaaggcgggaaaggggctgaccatcgtcggcacggtcgtctccggcaacttcctg
caaagctacggagaggccctcgctgccgagcagactctgaagcatctgatggataaggag
cgagtgaagggcttctgtcagtgcatcgtggctcagaaaccacgggagggtatcagccac
atgatccagtccagcggcctggggggaatgaaacccaataccgtggtgatgggctggcct
catgcctggaggcagagcgaggaccctcagtcctggaagaccttcatcaacacagtgcgg
gtgaccacagcggcccacctggctctgctggtgcccaaaaacatctctctgttccccagc
aacagcgagccatgcacggagggctacatcgacgtctggtggatcgtccacgacggaggg
atgctgatgctgctgcccttcctgctgcgccaacacaaagtgtggcgtaaatgcgggatg
cggatcttcaccgtggcccagatggaggacaattcaatccagatgaagaaggacctggca
accttcctgtatcacctccgcatcgaggccgaggtggaagtagttgagatgcacgacagc
gatatcagcgcgtacacttacgagaggaccctgatgatggagcagaggtctcagatgctc
agacagatgcggctgtctaaatccgaccgggagagagagggaaaccctggtagcagcagc
agtaggccagaggcaggtggagctacaaggtctcaggtgtatcttttccccaggtacagg
agtactggagtccacacctcaaacacctgcaaaggaaacagagacagacaggcccagctg
gtgaaagatcgtaactccatgctgcggctgacgagcatcggatcggacgatgacgacgac
acagacggcggagatcgagacaggccgacgagcagcggcggtggcggaggcagctccgag
catcagcgacgggttcagatgacctggaccaaagagaggacctcgcagtacagagccacg
cactccggctgctccacgcccgaaggcttcagagacatgctcagcatcaggccggatcac
tccaacgtcaggcggatgcacaccgccgtcaagctcaacgaggttatcgttaacaaatcc
cacgatgcccggctcgtcctgctcaacatgccgggacccccaaggaacacggagggagac
gagaactacatggagttcctcgaggttctaacagaaggattggagcgtgtcctgttggtc
cgaggaggaggaagcgaagtcatcaccatctactcctga

DBGET integrated database retrieval system