KEGG   Larimichthys crocea (large yellow croaker): 104933552
Entry
104933552         CDS       T04659                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04012  ErbB signaling pathway
lco04068  FoxO signaling pathway
lco04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104933552
   04068 FoxO signaling pathway
    104933552
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104933552
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104933552
NCBI-ProteinID: XP_027128250
LinkDB
Position
XX
AA seq 132 aa
MSDVRLSNASPTLERVDARQPDNVRPPVRRNLFGSPDREEIRRYVTAAMREDVQDFMEEY
NFDPVNDRPLTPRNYEWQEDSDAPEFFRRPPHHRDADSPGDNNRQDAEESSGRQSADRGQ
SLGKRRSGDQGE
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgcctttctaatgcgagcccgacattggagagggtggatgcgcggcag
ccggacaacgtcagacctccggtccgcagaaaccttttcggctcacctgaccgagaggag
atacggaggtatgtcacggctgcgatgcgggaagatgtgcaggattttatggaggagtac
aatttcgatcccgtcaacgacagaccgctcactccgcgcaattacgagtggcaggaggac
agcgacgcaccggagttttttcgccgaccgcctcaccatcgagatgcggactcgcccggc
gacaacaaccgacaggatgccgaggagagcagcggaaggcagtcggcagatcgcgggcag
agcttggggaaaaggcgttcaggagaccaaggtgagtga

DBGET integrated database retrieval system