KEGG   Larimichthys crocea (large yellow croaker): 104933588
Entry
104933588         CDS       T04659                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04012  ErbB signaling pathway
lco04068  FoxO signaling pathway
lco04110  Cell cycle
lco04115  p53 signaling pathway
lco04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104933588
   04068 FoxO signaling pathway
    104933588
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104933588
   04115 p53 signaling pathway
    104933588
   04218 Cellular senescence
    104933588
SSDB
Motif
Pfam: CDI SR-25
Other DBs
NCBI-GeneID: 104933588
NCBI-ProteinID: XP_010747388
LinkDB
Position
XX
AA seq 184 aa
MLTGEMAKVSPSTLTSTAAMASDSELSRLGGIEALNLKVGPVRRNLFGPVDHQQLQQDFQ
RLLCMSVEVANKRWNFDFQSEMPGNGTNVEWEELRCQDVPAFYRSCTVRAAAPLQDKRRT
SSSSSGDCSPGSSSSSGSGDEYLEVTTRGCYRLKRQGKRKQSAITDFFKVKKTKLLHYKA
SSRQ
NT seq 555 nt   +upstreamnt  +downstreamnt
atgttaacaggggaaatggctaaggtctctccatcaacattaacatcaacagcagcaatg
gcatctgactcagagctctcacgtcttgggggcatcgaggcattaaatttgaaggtgggg
ccggtgcggaggaacctcttcgggccggtggaccaccagcagctgcagcaggacttccag
cggctgctctgcatgagcgtggaagtggccaacaagcgctggaacttcgacttccagagc
gagatgccgggaaatggcaccaacgtcgagtgggaggagctcaggtgccaggacgtgccg
gcgttttaccgcagctgcacggttagggcagcggcgccactgcaggacaaaaggcggacg
tcttcttcgtcgtcaggcgattgttccccggggtccagcagctcgtccgggtctggggat
gagtatctggaggtgaccacaagggggtgctaccggctcaaacggcaaggaaaacgcaaa
cagtctgccatcacagatttcttcaaggtgaagaagaccaagcttctccattacaaagca
tcttcccggcagtag

DBGET integrated database retrieval system