KEGG   Larimichthys crocea (large yellow croaker): 104933745
Entry
104933745         CDS       T04659                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04210  Apoptosis
lco04620  Toll-like receptor signaling pathway
lco04621  NOD-like receptor signaling pathway
lco04622  RIG-I-like receptor signaling pathway
lco04623  Cytosolic DNA-sensing pathway
lco04625  C-type lectin receptor signaling pathway
lco04920  Adipocytokine signaling pathway
lco05132  Salmonella infection
lco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104933745 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104933745 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104933745 (ikbkg)
   04621 NOD-like receptor signaling pathway
    104933745 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    104933745 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    104933745 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    104933745 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104933745 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104933745 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104933745 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104933745 (ikbkg)
Protein kinases [BR:lco01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   104933745 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF2278
Other DBs
NCBI-GeneID: 104933745
NCBI-ProteinID: XP_019111052
LinkDB
Position
XV
AA seq 613 aa
MVQPQPDGPMQWEMSGEESGGALRVPPELAANEVVTRLLGDNQQLREALRRSNLALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQGLVNGPASSSNHCCSSSQTED
LQGRPARNGPLDGPQTLDQREKKQAEEMDQDTQTIPPRSLDDENSSLGSTLPSPPTSLSE
AWGELMGRENGQPVEGANEFLQLLKSHKEKLEEGMRELRKKNDELERERDEGDKEKEQMR
RCIDQLRARVAHQASNVTEEVVQHRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEKLDY
LQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELNERQSCLDKSEHERKML
EEKLCSKMKALQVAERDLEQQRKQHHVAMDKLLLQTQSLEQALKTERHVVTEEKKKLTQL
QHAYTCLFRDYDSKLKTEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQKGSLETVPVL
TAQAEIYKSDFLAEREAREKLNQKKEELQDQLTQALAEIDRFKQEATSRARIEQMKLRHL
EDFSTRPPPQGVFPGATFNTAPPAPAFRNQGLGPVGDQGAAGAEELPDLCCPKCQYQAPD
MDTLQIHVMDCIQ
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggtgcagccccagcctgatggcccgatgcagtgggagatgtcaggagaggagagcgga
ggggccctcagggtcccaccagagctggctgccaatgaagtagtgaccaggctgctgggt
gataaccagcagctgagagaggccctgcggcggagcaacctagccttgcgtcagcgctgt
gaggagatggagggatggcagcgcaggacaagagaggaaagagaattcctcagctgtcgt
ttccaggaggccagggccctggtggagaggctggcccaggagaaccactccttacagggt
ttggtgaacggaccagcgtcctcctcgaaccactgctgcagctccagccagactgaagac
ctgcaggggcgtccagcgaggaatggaccactggatggaccacaaactctggatcagcgg
gaaaagaagcaagctgaagagatggatcaggacacgcagaccataccgcctcgcagcctg
gatgatgagaatagctccctcggtagcaccctcccttctccccccacctcactttcagag
gcatggggggagttaatgggcagggagaatggtcagcccgtggaaggcgcaaatgaattc
ctccagttgttgaagagccacaaagagaaactggaggaaggaatgagagagctgaggaag
aagaacgacgagctggagagggagagggacgagggcgacaaagagaaagagcaaatgcgg
cgctgcattgatcagctacgggccagagtggcccatcaggccagcaatgtcacagaggag
gttgttcagcatcgctctgaggcacagcactcctctgactgctccagcctggctaaactc
acagagcagcttcaggccacacagggcaggtatcgcgagttggaggagaagcttgattac
ctgcagaagagttcagctcagcgggacaggactgaagctctcctcaaacagaaggacaag
gactgtgcccagctggctaaggactgcgaggcgctcaaagctcaagcaacttccctgtta
ggagaactgaacgagagacagagctgcctggacaaaagcgagcacgaacgtaaaatgttg
gaagaaaagctgtgcagtaagatgaaggccctgcaggtggcagagcgggacctggagcag
cagaggaagcagcatcatgtggccatggacaagctgctgctgcagacccagagcctggaa
caggctctgaagacagagagacatgtcgtcacagaggagaagaagaaactgacacaactg
cagcatgcctacacgtgtctttttagagactatgattctaaactgaaaactgagggagga
gatctgtgcagccgactagaggaggcagagagagcgctggccctgaagcaggacctgatc
gataaactgaaggaagaggtggagcaacagaaaggctctctggagactgttcctgtcctc
actgcacaggccgagatctacaagtcagatttcttagcggagcgagaggcgagagagaag
ctgaaccagaagaaggaggagctgcaggaccagctgactcaggccctggctgagattgac
aggttcaaacaggaagccacatcacgtgcacgtattgagcaaatgaagctgagacacttg
gaagacttttcaacacgtccacctccacaaggcgtgttccccggtgcaacttttaacact
gctcccccggcccccgcgttccgcaatcaaggtttgggaccagtcggtgatcaaggggca
gccggagctgaggagctgccagatttatgctgtcctaagtgccaataccaggccccagat
atggacacgctgcagatacatgtcatggactgcatacagtaa

DBGET integrated database retrieval system