KEGG   Larimichthys crocea (large yellow croaker): 104935153Help
Entry
104935153         CDS       T04659                                 

Gene name
tgm5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104935153 (tgm5)
Enzymes [BR:lco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104935153 (tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_core Transglut_C
Motif
Other DBs
NCBI-GeneID: 104935153
NCBI-ProteinID: XP_019131038
LinkDB All DBs
Position
Un
AA seq 731 aa AA seqDB search
MSVFDKVDFYCVKNNSAHRTIEISRDKLTVRRGQSFNVTLNLRQAFDPLNDPLKFTAITG
NYPSEDTGTMSLFGVPDNERRSTNAKAVWKAELQESYSLQILNLTITPPADAPIGEYIVM
VGYKNEETLLGELVVLYNPWCSDDWVFLPNEDERQEYVMNESGILYKGSGNYIMPSNWDF
GQFEDRMVEICMNLLDLNPKHLKDPSDDVSARCNPIYVSRVVSAMINSADDHGVLQGRWS
GSFAGGVLPSHWTGSYAILRQWLLNFFRPVKYGQCWVFAAVMCSVMRLLGIPCRVVTNFQ
SAHDRNQNLTIDVYHADYGVRERPTHDSVWNYHVWVEAWMRRPDLAEDGRYDGWQVLDPT
PQERSDGVYCCGPAPVKAILKGETHLKYDVPFVFAEVNADCVDWLVKADGSKITIWTDTQ
RVGQNISTKGIGTNDRMIITKNYKYKEGSSEERAVFSYACTRDCSSDCFEVKPMMMMNNN
ESTGNEERTPISGSAEITVNEESTCIAPVVPPLTIQFEEVSIPTVGADVSMNLLLQSPPE
ITDDKTLSITISIQSITYNCESSMSMKQEVKEEKLLAGKDLSIPILIPFKDYRKHLLDCD
TIKVSAVIADKQNPEEIYYAEQDIVLQDPPMSVTVSDHPKQDTESSAQVIFKNPIDETLT
GCSLTVSGSGLFKEEVKYKTPDMKPNTQIVVTFFFNPYKSGKKTLMVNFGCSIFRDITGS
CTVDVKPPQAA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcttcgacaaagtggacttttactgtgtcaaaaacaactctgctcaccgcacc
attgaaatctcacgggataaactgaccgtgagaagaggccagtccttcaacgtgaccctt
aatctgaggcaagctttcgaccctctcaatgatccactcaagttcactgcaattacagga
aactatccatctgaagacacagggacgatgtcattgttcggtgtccctgataatgagaga
cgttcaactaatgcaaaggctgtgtggaaggcagagctccaggaaagctactccctacaa
atcttgaacctgaccatcacccccccagctgatgcccctataggagagtacatagtcatg
gtgggatacaagaacgaggagacactgctgggagagctggtggttctttacaacccctgg
tgttctgatgactgggtgtttctgcccaatgaggacgagagacaggagtatgtgatgaat
gaatcaggaatcctctacaaaggaagcggaaactatatcatgccttcgaattgggacttt
ggacagtttgaggaccgcatggtggagatttgtatgaacttattggacctcaaccccaaa
cacctgaaggatccgtctgatgacgtttccgctcgctgtaaccccatctacgtcagtcgc
gtggtcagcgccatgatcaacagtgcagatgaccatggtgtactgcagggacgctggtca
ggatcttttgctggtggagtcttaccttctcactggactggcagctacgccatcctcagg
caatggctcttaaactttttcagaccggtcaagtacgggcagtgctgggtgttcgccgct
gttatgtgctcagtgatgcgcctgcttggcatcccctgccgtgtggtcaccaacttccag
tcagcccacgaccgcaaccagaatctgaccattgacgtgtaccacgctgactatggagtc
agggagagaccaacccatgacagtgtttggaactaccatgtctgggtggaggcatggatg
aggcgaccagacctggcagaggacggcaggtatgacggctggcaagttctggatccaacc
ccgcaggagaggagcgacggcgtttactgctgtggtccagccccagtcaaagccatcctg
aaaggagaaacacatctcaaatatgacgtcccattcgtctttgctgaggtcaacgccgac
tgtgttgactggctggttaaagctgacggttcaaagatcacaatttggacggacacacag
agagtcggtcaaaacatctccaccaagggcattggcaccaatgataggatgatcatcacc
aaaaactacaaatacaaagagggatcctccgaggagagggctgtctttagctatgcctgc
actagagactgctcctccgactgtttcgaagtgaagccaatgatgatgatgaataataat
gagagtactgggaatgaggagaggacgccgatatcgggaagtgctgagattacggtgaat
gaggagagtacctgcattgctccagtggtccctccattgaccattcaatttgaagaggtg
tccataccgacggttggtgccgatgtgagcatgaacctgttgctgcaaagtccgcccgag
atcaccgatgacaagacactgtccatcaccatcagcatccaaagcataacgtacaactgc
gaatcatccatgagcatgaagcaggaggtgaaggaggagaaacttctggctgggaaagat
ctgtccatccctatcctgatcccgttcaaggactaccgtaaacacctgttggactgtgac
accattaaggtgtcagccgtgatcgctgacaaacagaatccagaagagatatactacgct
gagcaagacattgtgctgcaggaccctcccatgtccgttaccgtgtccgatcaccccaag
caggacacggagtcaagtgcacaagtgattttcaaaaacccgatcgacgagacgctgact
ggctgctctctgactgtctctggaagtggcttgttcaaagaagaggttaaatacaagact
cccgatatgaagccaaacactcagatagtcgtcacgttcttcttcaatccctacaagtcc
ggaaagaaaactctcatggtcaacttcggctgctccatcttcagagacattacaggcagc
tgcaccgttgatgtcaagccaccacaggctgcgtaa

DBGET integrated database retrieval system