KEGG   Larimichthys crocea (large yellow croaker): 104936027Help
Entry
104936027         CDS       T04659                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00250  Alanine, aspartate and glutamate metabolism
lco00410  beta-Alanine metabolism
lco00430  Taurine and hypotaurine metabolism
lco00650  Butanoate metabolism
lco01100  Metabolic pathways
Module
lco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104936027
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104936027
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104936027
   00430 Taurine and hypotaurine metabolism
    104936027
Enzymes [BR:lco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104936027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 104936027
NCBI-ProteinID: XP_010750267
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MDFLQRPHRIIDKSAVRDKQQDDSAAGRDRRQTPADFSNIYSKDLLPASHGEELTRGFLQ
ELVNILLEYICKSNQRSSKVLDFHHPHQLKEGLEGFSLNLPDQPETLEQLLVDCRDTLKY
GVSTGHPRFFNQLSSGLDVIGVAGEWLTSTANTNMFTYEVSPVFILMEEVLLRKMQSIVG
WSDEEGDGIFCPGGTISNLYSILVARYHFYPEVKTRGMGALPQLALFTSEHSHYSVKKSA
AVLGLGSENVVTVKCDERGKMIPAELESAIVTAEEKGLVPFYVNATAGTTVYGAFDPLDD
VADICNRHTLWMHVDAAWGGGLLMSDRHRMKLQGIERAWSVTWNPHKMMGVPLQCSVILV
KKKGLLKECNEMGAEYLFQTDKPYDVSYDTGDKSIQCGRHVDAFKLWLMWKAKGSEGFGA
QVDKCLENAEYLYDQLQRRAGFELVFKNKPEHCNVCFWYTPPSLRGLPPGEDRDTRLHQV
APQIKGKMMEKGSVLIGYQPFGAKVNFFRCVFSNPATQHEDIDFLLEEIIWLSHDL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttacaacggccacacagaatcattgataaatcagctgtgagggacaaacag
caggacgactcagcagcaggcagagacagaagacagacacctgcagatttcagcaacatc
tacagcaaagacctgctcccagcttcacatggtgaggagttgaccagagggtttctgcag
gagctggtcaacatcttgttggaatatatctgcaagtcaaatcagaggagctccaaggtc
ctggacttccaccatcctcaccagctgaaggagggactggagggcttcagtctcaacctg
ccggaccaaccagaaactctggaacagttactagtggactgcagagacacactcaaatat
ggtgtcagtacaggccatccccgtttctttaaccagctgtcttcaggtttggatgtgatt
ggtgtagctggcgagtggctgacctccactgccaacactaatatgtttacatatgaagtg
tctcccgttttcatcctcatggaggaggttctgctgagaaagatgcagagcattgtgggg
tggtctgacgaagaaggagatggaatcttctgtccaggaggcacaatatccaacctgtac
agcatcctggtggccaggtatcacttctatccggaggtgaagaccagagggatgggagct
ctgcctcagctagccctcttcacttcagaacatagtcactattcagtaaagaaatctgca
gctgtgctggggctgggcagcgagaatgtggtcacggtgaaatgtgatgaaagagggaaa
atgatacctgctgaactggagtctgccattgttacagctgaggaaaagggtttggttcca
ttctacgtgaatgcgacagcaggtaccactgtgtacggggccttcgatcctctcgatgac
gtcgcagatatctgcaatcgacacacactgtggatgcacgttgatgcagcgtggggtgga
ggcctgctgatgtcagacagacacaggatgaaactacagggcattgaacgagcctggtct
gtaacatggaatcctcataagatgatgggtgtccctctgcagtgctctgtcatactggtc
aagaagaaaggtctcttaaaggagtgtaatgagatgggggctgagtaccttttccagacg
gacaaaccctacgatgtgagctatgataccggggataagagcatccagtgcggccggcat
gtggatgcctttaaactttggctcatgtggaaggcaaagggctcagagggttttggagct
caggtcgacaaatgcttagagaatgccgagtatctgtatgatcagctgcagaggagggcc
ggctttgaactggtcttcaaaaacaaaccagagcactgtaatgtgtgtttttggtacact
cctcccagtctgagaggcctgccacctggagaggacagagacacaagactccatcaggtg
gctcctcagatcaaaggcaagatgatggagaaaggctctgttctgattggctatcagcct
tttggagccaaagtcaatttcttcaggtgcgtgttctccaatcctgccacacagcatgaa
gacattgacttcctgctggaggagatcatctggctcagccatgacctgtga

DBGET integrated database retrieval system