KEGG   Larimichthys crocea (large yellow croaker): 104936561Help
Entry
104936561         CDS       T04659                                 

Gene name
ganc
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00052  Galactose metabolism
lco00500  Starch and sucrose metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104936561 (ganc)
   00500 Starch and sucrose metabolism
    104936561 (ganc)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104936561 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104936561
NCBI-ProteinID: XP_019133377
LinkDB All DBs
Position
Un
AA seq 895 aa AA seqDB search
MAGESQPDSVVPDDDCKEKFKKSDDVAFYRRQMQGPSMQHRALLDTMVLTEKGARFELLE
PDTQTSLLLSVSPCKDDTVRILIDELRPIKARYRVPDVITGEGARCEQLRVERKSKDSVT
LSWSSGRHQVRVWHFPFRLEILCDDEVTLTFNHKGKLWFETLQDPPSELQDDHTGLLWKE
TFRQFVDIKANGPSSIGSDLCFHGFSHVYGLPEHADGLQLRDTRDGEPYRLYNLDVFAYD
VYSRLGLYGSVPLLVAHNPDRTLGVFWLNASETFVNVRYSPSEHQDDQTPPVKRKRMQPQ
TDVHWLSESGVIDCVVLLGPGPQQLFSQYAQLTGFPALPPLFALGYHQCRWNYDDEADVK
AVDAGFDRHGIPYDVIWLDIEHTDGKRYFTWDPALFPEPAGLQRHLEEKKRRLVVISDPH
IKVDPDWSLYCEARDGGHFVKNREGRIYQGSCWPGESSYLDFSNPDTRAWYSRCFGVDKY
KGSTASLFVWNDMNEPSVFHGPEQTMPKDAVHHGGWEHRELHNLYGFFQHMATAEGLITR
SGGLERPFVLSRSFFAGSQRFGAVWTGDNVASWEYLKISIPMVLSLSVAGIVFCGADVGG
FVQDPEPELLVRWYQAAALQPFFRGHSAKVTKRREPWLFGDEVTAAIRTVIQERYCLLPY
WYTLFYLAHTSGLPPLRPLWVEFQKEESAFTVDSQYMIGGALLACPVTEPGVQQVQVLLP
GCGEVWYDVRSAEVHEGGRTLSLPVTLDTVPVFQRGGSVVCRSTGSGSCTAEYQQLPLSI
TVALNSQAVADGELYLDDGHSFSYRDRKAFCLRRFSMLSGRLVCRPAGEKGMFGCDTAIQ
SVTVLGVKSAPSAVVVHVPGAKDASAAFQYTETCCMLTVTDLNLKATTDWEMLIL
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagagagccaacccgacagtgttgttcctgatgatgactgcaaagaaaagttc
aagaaaagtgacgatgttgctttttacaggcgacagatgcagggcccgagcatgcagcac
cgagccctcctggacaccatggtgctcacagagaagggggctcgattcgaactgttggag
ccggacacacagacgtcgctgcttctctctgtgtcaccttgcaaagacgacactgtcagg
atcctcatagacgagctccggcccattaaagcacgctaccgagttccagatgtgataacg
ggggaaggagcgcggtgtgaacagttgagagtggagaggaagtcgaaggactccgtcacc
ctttcttggtcgtcaggccgtcaccaagtccgtgtgtggcatttccctttccgactggag
atcctgtgtgacgacgaagtgacgctcaccttcaaccataaaggcaaactgtggtttgag
actctgcaggatccacccagtgagcttcaggacgaccacacaggtttattatggaaagag
actttcaggcagtttgtggatatcaaagcaaatggtcccagcagcatcggctctgacctc
tgtttccacgggttcagtcacgtgtacggactaccagagcacgctgacggccttcagctc
agagacaccagagacggtgaaccttaccggctgtataatttggacgtctttgcgtacgac
gtgtacagccgcctcggcctgtacgggtccgtgccgctgttggtggcccacaatcccgac
cggactttgggcgtattttggctgaatgcatctgaaacttttgtgaacgttcgttacagc
ccatctgagcatcaggacgaccaaacacccccagtgaagcggaagcggatgcagcctcag
acagacgtgcactggctgtcagaaagtggtgtgattgactgtgtggttctgctcgggccc
ggtccacagcagctcttctcccagtatgctcagctgacaggatttccagccctgcctcct
ctgtttgctctcgggtaccaccagtgtcgctggaactatgacgacgaagctgacgtgaag
gctgtggacgctggattcgatcgtcacggcatcccgtacgacgttatctggctggatatc
gagcacacggacgggaagcgatatttcacctgggatcctgctctgttccctgaaccggcc
ggtctgcagcgccacctagaggagaagaagagaaggttggttgttataagtgatccccac
atcaaggttgatcctgattggtcgctgtactgtgaggccagagacggaggacactttgtc
aagaacagagagggacggatctatcagggctcgtgctggcctggtgagtcgtcttacctt
gacttcagcaatccagacactcgagcgtggtactccagatgttttggagtcgataagtac
aagggttcgacggcgtcgctgtttgtgtggaatgacatgaatgaaccgtctgtgttccac
gggccggagcagacgatgccaaaggacgcggtgcatcatgggggctgggaacaccgtgaa
ctgcacaacctgtacggcttcttccagcacatggccacagcggagggtctgataactcgc
tcaggtggcttagagagaccttttgtcctttcccgctccttcttcgctgggtcacaaaga
tttggagcggtatggacaggtgacaacgtcgccagttgggagtacctgaagatctcgatc
ccaatggttctgtctctgagcgtggctgggattgtattttgtggagccgatgtcggtggc
tttgttcaggacccggagccggagctgttggtgcgttggtaccaggcggccgccctgcag
ccgtttttccgaggtcactctgcaaaggtgacaaagcgtcgagagccctggctgttcgga
gatgaagtcaccgctgcgatccgcaccgtgatccaagagaggtactgtttgctgccgtac
tggtacactctgttttacctggctcacacctcaggtctgcctccactcagacctctgtgg
gtggagttccagaaagaagagagcgccttcactgtggacagccagtatatgatcggagga
gcgctgctggcctgtcctgtgactgagccgggtgttcaacaagtccaagtgttactgcct
ggatgtggtgaggtgtggtacgatgtccgctctgcagaggtgcatgaaggaggcaggact
ctgagtcttccagtcaccctggacacagttcccgtgttccagcgtggcggctcggtggtc
tgcaggtcaacgggaagtggctcctgtaccgccgaatatcagcagctccccctctccatc
accgtggccctcaacagtcaggccgtcgctgatggtgagttgtacctggacgacggccac
tccttcagctaccgtgacagaaaggccttctgcctgcgccggttcagcatgctgtcaggc
cgtctggtctgccgtcctgccggtgaaaaaggaatgtttggctgtgataccgcgatacag
tcggtcaccgtcctcggcgtgaagagcgcaccgtccgcggtggttgtgcacgtgcccgga
gctaaagacgcctcggctgcgttccaatacacggagacctgctgcatgctgacggtgacc
gacctgaacctcaaagcgacgacggactgggagatgctgatcctgtag

DBGET integrated database retrieval system