KEGG   Larimichthys crocea (large yellow croaker): 104938150Help
Entry
104938150         CDS       T04659                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104938150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lco01002]
    104938150
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104938150
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104938150
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104938150
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104938150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 104938150
NCBI-ProteinID: XP_019131641
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKYFILLALFAAAFAAPIDDEDDKIVGGYECRKNSVPYQVSLNSGYHFCGGSLISSTWVV
SAAHCYKSRVQVRLGEHNIAVNEGTEQFISSAKVIRHPRYSSRNLDNDIMLIKLSKPATL
NSYVRTVSLPSSCASSGTSCLISGWGNTSSSGSNYPDRLRCLNAPILSDSSCRNSYPGQI
TSNMFCAGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYAKVCNYNSWI
RSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttcattctcctggctctgttcgctgcagcctttgctgctcccatcgatgat
gaggatgacaagattgttggaggctacgagtgcagaaagaactctgtgccctaccaggtc
tctctgaacagcggctaccacttctgtggaggctccctgatctccagcacctgggtggtg
tctgctgctcactgctacaagtcccgcgtgcaggtgcgtcttggtgagcacaacattgct
gtcaatgagggtacagagcagttcatcagctctgctaaggtcatccgtcaccccagatac
agcagccgcaacctggacaatgacatcatgctcatcaagctgagcaagcccgccaccctg
aacagctacgtccgcaccgtgtccctgccctccagctgtgccagctctggcaccagctgt
ctgatctctggatggggcaacaccagcagctctggaagcaactaccctgatcgtctgagg
tgcctgaatgcccccatcctgagcgacagcagctgcaggaactcctaccctggtcagatc
acctccaacatgttctgtgctggattcctcgagggaggcaaggactcctgccagggagac
tctggtggccccgtggtgtgcaacggtcagctgcagggtgttgtgtcctggggttatggc
tgcgcccagaggaacaagcctggtgtctacgccaaggtctgcaactacaactcctggatt
cgcagcaccatgtcctccaactaa

DBGET integrated database retrieval system