KEGG   Larimichthys crocea (large yellow croaker): 104938333
Entry
104938333         CDS       T04659                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104938333
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104938333
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lco03310]
    104938333
Transcription factors [BR:lco03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    104938333
Nuclear receptors [BR:lco03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   104938333
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 104938333
NCBI-ProteinID: XP_019121046
LinkDB
Position
I
AA seq 771 aa
MDKGGVKKITHRRDDHLSKLVYTESPEEGGLLKVAPHSAVSITTPATSVVLPSSPFMQPG
QVPNGLSNSPLPEELTSVTAIVGPFLEDQESRSLTKDQKLQQQLLQTHTFGHQTLRGNLP
QLEAMDSLIGGSDPNFFPMKTEDFSMDKGDQEPIDLDHAFEHIGKDVDVQQKLFSDNALD
LLQDFELIGSPSDFYVGDDAFLTSLADDSLLEDVSSEKDLKTAAADSIISSGAISVAVNG
STMTSPDLSCSSISTTASLTPTTTLSVLVKKEKDGGFIQLCTPGVIKQEKSSADQSYCQI
SGTSSTDMPSSNSISICGVSTSGGQSYRFGVNPSSNEAQQQKDQKLVSSMYLPVTTIGGP
WNRGQGVGDNSAMHRASEAFSSPSYPSFASPTSRQEAITAVTQGKSGTHKICLVCSDEAS
GCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYSKCKMAGMNLE
ARKTKRLARIKDSNRGNQQSNPPELTPPPIEACSPLKCLPQLVPTMLSLLKAIEPDTIYA
GYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSF
GLGWRSYQQCSGNMLCFAPDLVINEERMKLPYMADQCEQMLKISSEFVRLQVSHDEYLCM
KVLLLLSTVPKDGLKSQAVFDDIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMH
EMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFRAGSVKPLLFHQR
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggataaaggtggagtgaagaagataacacacaggagagatgaccatttaagcaaactg
gtctacaccgaaagccctgaggagggaggtctgttaaaggtggctcctcacagcgctgtg
tccatcaccacacctgccacgtctgtcgttcttccatccagcccgttcatgcagccagga
caggtgcccaacggcctcagcaacagccctctaccagaggaactcacctctgttactgcc
atcgtaggcccctttctggaagaccaagaatccaggagcctgaccaaagatcagaagctg
cagcagcagttactccagacacatacgttcgggcatcaaaccttgaggggaaatttgccc
cagttggaggccatggattcactcatcgggggatcggatcccaacttcttcccgatgaaa
acagaagacttctccatggataaaggagaccaggaacccattgacctcgatcatgccttt
gagcacattgggaaagatgtggacgtgcagcagaagttgttcagtgacaacgctctggac
ttgctccaagacttcgagctcattgggtccccttcagatttttatgtaggggacgatgcc
ttcctgacctctctggcagatgattctctgctcgaggacgttagctcggagaaggaccta
aagactgctgcggctgacagcattatcagcagtggggcaatctctgttgctgtcaatggt
agcactatgacaagtccagatctgtcctgctctagcatatccacaactgcctccctaacc
cctacaaccactttgtctgtgttagtgaagaaagagaaagacggtggcttcattcagctc
tgcaccccgggtgtgatcaagcaggagaagtcgtctgcagaccagagttattgccaaatt
agcggcacgtcctccactgacatgccgagctctaactccatctccatctgcggggtcagc
acttcaggaggacagagctaccgcttcggagtcaaccccagcagcaatgaagctcagcag
cagaaggatcagaagttggtgtccagcatgtatctcccagtgacgaccatcggtgggccc
tggaacagaggccagggtgttggggacaactcagcaatgcaccgggccagtgaggctttt
agctctccctcttaccccagctttgccagccctacctccagacaggaagcgatcaccgct
gtgacacagggaaaaagcgggactcataaaatctgcctggtgtgctctgacgaggcctcg
ggctgccactacggcgttctcacctgcggcagctgcaaggtcttcttcaagagagcggtg
gaagggcagcataattacctgtgcgctggaaggaacgactgcataatagacaagatcagg
agaaagaactgcccagcctgccgctacagcaagtgtaagatggcaggcatgaacctggaa
gcgcgcaaaaccaaaaggttggcccgcataaaggactcaaacagaggcaatcagcagagc
aacccgcccgagctgacgcctccgccaatagaggcttgctcccccctaaagtgcctgcct
caactcgttcccacaatgttgtccttgctcaaggccatcgagccggacaccatttacgcc
ggctacgacagcaccctgcctgacacctccacccgcctcatgaccaccctcaacaggctg
ggcggtcggcaggtcatctctgcagtcaagtgggccaaggctctgccaggtttcaggaac
ctgcacctggacgaccagatgactctgctgcagtgctcctggctcttcctcatgtctttc
ggtcttggctggaggtcttaccagcagtgcagtggcaacatgctctgcttcgcgccagac
ctcgtcatcaatgaggagcggatgaagctgccctacatggccgaccagtgcgagcagatg
ctgaagatctccagcgagttcgtccggctgcaggtttcccacgacgagtatttgtgcatg
aaggtcctgctgctgctcagcacagtgccaaaggatggcctgaagagccaggcggtgttc
gacgatatccggatgtcgtacatcaaggagctggggaaagccattgtgaagcgtgaggag
aactccagccagaactggcagcgtttctatcagctcaccaagctgctcgactccatgcat
gagatggtcggcggactgctcagcttctgcttctacacctttgtgaataaatccctgagt
gtcgagttcccggagatgctggcggagatcatcagtaaccagttaccaaaattcagggcc
ggcagcgtcaaacctctcctcttccaccagagatga

DBGET integrated database retrieval system